PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g12400.1
Common NameHAZ1, LOC4340565, Os06g0229300, OSNPB_060229300, P0525F01.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-PHD
Protein Properties Length: 793aa    MW: 87306.4 Da    PI: 4.9044
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g12400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.32e-116226621252
                       HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        + L+++F++++yps++++e LA++lgLt +qV+ WF   R
  LOC_Os06g12400.1 622 NQKLKAHFKEDPYPSRATKENLAQELGLTFNQVTKWFSSTR 662
                       589**********************************8776 PP

2PHD42.81.2e-14246301151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C++Cg+   + +++++lCdg C++ fH++Cl+++l  e++p+g   wlC+ C++k
  LOC_Os06g12400.1 246 FCAACGSkdVTLKNDIILCDGiCDRGFHQYCLNPPLLAEDIPQGdeGWLCPACDCK 301
                       7******64445********88*********************999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.37E-14236304IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.109.3E-14242300IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.941244301IPR019787Zinc finger, PHD-finger
SMARTSM002492.4E-10246299IPR001965Zinc finger, PHD-type
PfamPF006286.5E-12246301IPR019787Zinc finger, PHD-finger
CDDcd155043.44E-26246298No hitNo description
PROSITE patternPS013590247298IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.183608668IPR001356Homeobox domain
SMARTSM003897.1E-12611672IPR001356Homeobox domain
CDDcd000862.40E-12613666No hitNo description
SuperFamilySSF466892.01E-11613675IPR009057Homeodomain-like
PfamPF000466.7E-9622662IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-12622677IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MDKTTTSDLV LDNDNIGSNA GSAQEPLTTN GKTSGVRNRY KQTVKRGRKG SQISPSKTYP  60
LRSSHSNVRV LRSASKKKNE TPIVPTNDNT AVQRVAKKRK RSKPLRPAPS RVLRSTSEKK  120
NKAHNELLND GAGVQPAEKK RKVGRPPKGG TPKDDYLMIR KRVRYVLNRM NYEQSLIQAY  180
ASEGWKGQSL EKIRPEKELE RAKVEILRCK SRIREAFRNL DSLLSEGKLD ESMFDSAGEI  240
SSEDIFCAAC GSKDVTLKND IILCDGICDR GFHQYCLNPP LLAEDIPQGD EGWLCPACDC  300
KIDCIDVLNE LQGVKLSIHD SWEKVFPEAA SFLNGSKQID ASDLPSDDSA DNDYDPTLAQ  360
GHKVDEEKSS GEDGGEGLDS DDSSSEDSES SEKEKSKTSQ NGRTVDDLGL PSEDSEDGDF  420
DPAGPDSDKE QNDESNSDQS DESDFTSDSD DFCAEIAKSC GQDEISGPSS SQIRTVDRTD  480
GSGFDGEPNA ENSNLAFMET ELEQDMVLPI SSKRQVERLD YKKLYNEAYG KASSDSSDDE  540
EWYGNSTPEK GNLEDSETDS LAESPQGGKG FSRRAPVRYH NNEHTPQNVR PGGSVSDQQT  600
EVLCSNSNGS TAKNRHFGPA INQKLKAHFK EDPYPSRATK ENLAQELGLT FNQVTKWFSS  660
TRHYARVAAT KKENNIENHT AENNNNTNTV DSIQLRGSND IVSVDRNDMV SEERTGQSNL  720
NEGTPLRSDT SCGQSVAVTP MVHPENQGND SSSNVRTPNA KSAEKLIPGL ENSDEARRKA  780
VQRELRKMKT GR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196101KKRKRS
296103KKRKRSKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.174250.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154672290.0
Expression AtlasQ8H991-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g12400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g12400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9401970.0FJ940197.1 Oryza sativa Japonica Group clone KCS150D11 PHD-finger family homeodomain protein mRNA, complete cds.
GenBankAB0813400.0AB081340.1 Oryza sativa Japonica Group HAZ1 mRNA for PHD-finger family homeodomain protein, complete cds.
GenBankAK1213140.0AK121314.1 Oryza sativa Japonica Group cDNA clone:J023113A13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644127.10.0PREDICTED: homeobox protein HOX1A
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLQ8H9910.0Q8H991_ORYSJ; Os06g0229300 protein
STRINGLOC_Os06g12400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18301539
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.15e-87Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain
Publications ? help Back to Top
  1. Ito Y,Chujo A,Eiguchi M,Kurata N
    Radial axis differentiation in a globular embryo is marked by HAZ1, a PHD-finger homeobox gene of rice.
    Gene, 2004. 331: p. 9-15
    [PMID:15094187]