PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g12360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 922aa    MW: 104713 Da    PI: 7.6805
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g12360.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.41.2e-27798848252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek +++e +s+yF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  LOC_Os06g12360.1 798 EKALTFELVSQYFYMPITQAARELNVGLTLLKKKCRELGIPRWPHRKMKSL 848
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513755.338129IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.102.3E-119297IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513758.6813064IPR002885Pentatricopeptide repeat
PfamPF015350.543258IPR002885Pentatricopeptide repeat
PfamPF128541.6E-993122IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.74895129IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.1E-797125IPR002885Pentatricopeptide repeat
SuperFamilySSF484527.11E-598265IPR011990Tetratricopeptide-like helical domain
PfamPF015352.5E-4129155IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007566.4E-5129156IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.974130156IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.133157192IPR002885Pentatricopeptide repeat
PfamPF015350.0065160181IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.966193227IPR002885Pentatricopeptide repeat
PfamPF015352.4E-4196220IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007567.2E-5196220IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.567238272IPR002885Pentatricopeptide repeat
PfamPF015351.9E-4240269IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007568.9E-5240270IPR002885Pentatricopeptide repeat
PfamPF015351.6E-6271297IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007560.0012271296IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.193273299IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.709300334IPR002885Pentatricopeptide repeat
PfamPF015352.3E-5302331IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.9E-4302331IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.102.3E-11329361IPR011990Tetratricopeptide-like helical domain
PfamPF130412.7E-9332378IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.2E-5333366IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.068335365IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.086366396IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.103.3E-6397462IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513758.594400430IPR002885Pentatricopeptide repeat
PfamPF015350.0072405430IPR002885Pentatricopeptide repeat
PfamPF130414.2E-11431479IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.255432466IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007565.9E-7434467IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.487467497IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007560.0016469501IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.059503533IPR002885Pentatricopeptide repeat
PfamPF015350.55507531IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.103.3E-6566590IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513756.544569603IPR002885Pentatricopeptide repeat
PROSITE profilePS5151918.974784868IPR003035RWP-RK domain
PfamPF020424.7E-21801848IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016554Biological Processcytidine to uridine editing
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 922 aa     Download sequence    Send to blast
MRHNRSLAAL LRAGRYGAAR RLFDALPARS VVTWNSLLAG LARRPDARAA REFFDAMPVR  60
DAVSWNTLLA AYSASPHPDH LAAARRLFDE MPQRDVVTWN TLLGAYARRG LMDEARRLFD  120
EMPQRNAASW NTMVTGFFAA GQVVKALDVF DAMPAKDSAS LSTMVSGFTK NGMLHEAEEL  180
LTKRLSVTDM DKAVDAYNTL IVAYGQAGRF SDAKRLFDMI PKGQYQHNML KRKGFERNVV  240
SWNSMMICYI KAGDVCSARA LFNEMPDKDL VSWNTMISGY TQASDMKESE KLFWEMPDPD  300
TVSWNLIIQG FMQKGEAEHA RGFFDRMPER GTISWNTMIS GYEKNGNYIS SVKLFSKMLE  360
VGEIPDRHTF SSVLAACASI PMLGLGAQIH QLVEKSFVPD TAISNALITM YSRCGALNDA  420
EAIFKQMHTK KDLVSWNALI GCYEHHGRAT KALQLFKEMR RAKVMPTHIT FVSLLSACVN  480
AGLVSEGRMV FDTMVHEYGI VARIEHYAAL VNLIGRHGQL DDALEVINSM PMAPDRSVWG  540
AFLGACTAKK NEPLAQMAAK ELSTINPDSS APYVLIHNLH AHEGKWGSAA VVREEMERQG  600
IYKQPGYSWI DLEGKMHVFI SGDTWHPNAQ EIFSVLEDWQ WHNPMSLEMN QLTQVKLIAK  660
RNNQIMDKQA TATKMHKATN IRHIYSKFKV DEQQNTSWWP YCTSLWPDSY LLEEEALFSS  720
LSFPSFHPQP VYSTVMQSNV LQDELGVIFE DDVLKYWDEM EQSENKVEKS EKGLPLLYYG  780
DENGAASKIM RDDVRSEEKA LTFELVSQYF YMPITQAARE LNVGLTLLKK KCRELGIPRW  840
PHRKMKSLQT LINNVQVLQE ASKANNEEQL RMLVEMLQEE RRLLEQKPYV QLEEKTKRLR  900
QACFKANYKK RRLLALEAGE P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5i9d_A1e-5836012421pentatricopeptide repeat protein dPPR-U8A2
5i9g_C2e-5836011421pentatricopeptide repeat protein dPPR-U8C2
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g12360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g12360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0035690.0AP003569.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0425F05.
GenBankAP0035090.0AP003509.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0525F01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642248.10.0PREDICTED: pentatricopeptide repeat-containing protein At1g62260, mitochondrial
TrEMBLI1Q0W40.0I1Q0W4_ORYGL; Uncharacterized protein
STRINGLOC_Os06g12360.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP344
MonocotsOGMP108991212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-35RWP-RK domain-containing protein