PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g11970.1
Common NameLOC4340529, mads63, Os06g0223300, OsJ_20643, OSNPB_060223300, P0638H11.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 361aa    MW: 40068 Da    PI: 4.3965
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g11970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.23.4e-26958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien  nrqvtfskRrng++KKA+ELSvLCd+++a+++fs++g+l  +s
  LOC_Os06g11970.1  9 KRIENIPNRQVTFSKRRNGLIKKAYELSVLCDIDIALLMFSPSGRLSHFS 58
                      79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.903161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-36160IPR002100Transcription factor, MADS-box
CDDcd002651.30E-35278No hitNo description
SuperFamilySSF554552.22E-28284IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-25323IPR002100Transcription factor, MADS-box
PfamPF003194.9E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRVKLQIKR IENIPNRQVT FSKRRNGLIK KAYELSVLCD IDIALLMFSP SGRLSHFSGR  60
RRIEDVLTRY INLPESDRGG TIQNREYLIN MLTQLKCESD VTEDLTNTSS KAPVNSNIEE  120
LQQEIRRCQH QMQLTEEQLR MFEPDPARSA SMEDVEASEK FIAGILSRVE ERKRYLLCSM  180
GSFDVTASTS AMQHLYLPQQ HQHGDITDNG FGSDEVASWV SEGMPPTTSS VASIFAGTSD  240
SMMSFRDQAV YDTMRQDACV DQTVVPEMGM CHVDQQNQSD DWQAYTSAEF LNALIPPTPF  300
PLDDEDTMGP MLASSPLLMP GIHDQQPPVE DMATAGCSQA PANDGNGLYA AEDIAPVNVG  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-16175174Myocyte-specific enhancer factor 2B
1tqe_R1e-16175174Myocyte-specific enhancer factor 2B
1tqe_Q1e-16175174Myocyte-specific enhancer factor 2B
1tqe_P1e-16175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.498220.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884390.0
Expression AtlasQ67UI9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g11970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g11970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN6631300.0FN663130.1 Oryza sativa Japonica Group mRNA for MADS63 protein, cultivar Nipponbare.
GenBankAK1117760.0AK111776.1 Oryza sativa Japonica Group cDNA clone:J023075K19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641968.10.0PREDICTED: agamous-like MADS-box protein AGL66 isoform X1
TrEMBLQ67UI90.0Q67UI9_ORYSJ; MADS63 protein
STRINGLOC_Os06g11970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.16e-74AGAMOUS-like 66
Publications ? help Back to Top
  1. Kwantes M,Liebsch D,Verelst W
    How MIKC* MADS-box genes originated and evidence for their conserved function throughout the evolution of vascular plant gametophytes.
    Mol. Biol. Evol., 2012. 29(1): p. 293-302
    [PMID:21813465]