PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g11780.1
Common NameLOC4340520, Os06g0221000, OSNPB_060221000, P0516A04.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 323aa    MW: 36126 Da    PI: 6.1748
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g11780.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEde+l  +++++G  +W+  ++  g++R++k+c++rw +yl
  LOC_Os06g11780.1 14 KGPWTPEEDEKLMSYIQKHGHASWRVLPELAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding55.31.5e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  LOC_Os06g11780.1  67 RGNFSREEEQTILQLHSILGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.93961IPR017930Myb domain
SuperFamilySSF466892.2E-3111108IPR009057Homeodomain-like
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
CDDcd001672.82E-101661No hitNo description
PROSITE profilePS5129427.26462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2765117IPR009057Homeodomain-like
SMARTSM007172.7E-1766114IPR001005SANT/Myb domain
PfamPF002492.3E-1667112IPR001005SANT/Myb domain
CDDcd001676.94E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRPPCCDEN GLKKGPWTPE EDEKLMSYIQ KHGHASWRVL PELAGLNRCG KSCRLRWTNY  60
LKPDIKRGNF SREEEQTILQ LHSILGNKWS AIAKHLPGRT DNEIKNFWNT HLRKKLIKMG  120
IDPMTHCPRT DFFQSLPQLI ALANLRQIIE RQPWDGHIEG LQTVAVQAAK LEYMQSLLHS  180
AVSIVTSPTT TTTTSSLNTF TTELEQTNHL CPPQVPSSSV PELAVQVPHS QMPSTSFDQE  240
IGKTNLFSNN IVNGNEWCSM EADNSSQKSL LVPENSIPPL IDMPVQNFCN TISTPNCDGG  300
NSIPLPSWSE ILLDEELMGE FA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-30121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-30121162105C-Myb DNA-Binding Domain
1msf_C1e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154671490.0
Expression AtlasQ67VZ4-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g11780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g11780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0047270.0AP004727.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0516A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644332.10.0PREDICTED: myb-related protein 330
SwissprotQ8GWP02e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLQ67VZ40.0Q67VZ4_ORYSJ; Os06g0221000 protein
STRINGLOC_Os06g11780.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.16e-99myb domain protein 93