PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g11330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22167.9 Da    PI: 4.6867
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g11330.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.17.2e-261059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rie+   rqvtfskRr g++KKAeEL vLCda+va+++fsstgkl  ++s
  LOC_Os06g11330.1 10 RIESAAARQVTFSKRRRGLFKKAEELAVLCDADVALVVFSSTGKLSQFAS 59
                      8*********************************************9986 PP

2K-box50.21.1e-17861493598
             K-box  35 qRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                         ++ Ge+Le Ls++eLqq+e++Le +l+++  +K++ ++++i+elq+k  +l een++Lr ++
  LOC_Os06g11330.1  86 DLNMRGEELEGLSVEELQQMEKNLEAGLQRVLCTKDQQFMQEISELQRKGIQLAEENMRLRDQM 149
                       369*********************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.104161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-24323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-29374IPR002100Transcription factor, MADS-box
PfamPF003193.6E-251057IPR002100Transcription factor, MADS-box
CDDcd002652.33E-321375No hitNo description
PRINTSPR004046.6E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.08759155IPR002487Transcription factor, K-box
PfamPF014861.5E-1588149IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MARERREIRR IESAAARQVT FSKRRRGLFK KAEELAVLCD ADVALVVFSS TGKLSQFASS  60
NMNEIIDKYT THSKNLGKTD KQPSIDLNMR GEELEGLSVE ELQQMEKNLE AGLQRVLCTK  120
DQQFMQEISE LQRKGIQLAE ENMRLRDQMP QVPTAGLAVP DTENVLTEDG QSSESVMTAL  180
NSGSSQDNDD GSDISLKLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-19372271Myocyte-specific enhancer factor 2A
3mu6_C2e-19372271Myocyte-specific enhancer factor 2A
3mu6_B2e-19372271Myocyte-specific enhancer factor 2A
3mu6_A2e-19372271Myocyte-specific enhancer factor 2A
1tqe_S3e-19173173Myocyte-specific enhancer factor 2B
1tqe_R3e-19173173Myocyte-specific enhancer factor 2B
1tqe_Q3e-19173173Myocyte-specific enhancer factor 2B
1tqe_P3e-19173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.498370.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379885220.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g11330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g11330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3452230.0AY345223.2 Oryza sativa (japonica cultivar-group) transcription factor MADS55 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641679.11e-129PREDICTED: MADS-box transcription factor 55 isoform X2
SwissprotQ69TG51e-128MAD55_ORYSJ; MADS-box transcription factor 55
TrEMBLA0A0E0DYW91e-144A0A0E0DYW9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA021662-PA1e-129(Oryza sativa Indica Group)
STRINGLOC_Os06g11330.11e-129(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP12213697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.16e-35MIKC_MADS family protein