PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g10900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 224aa    MW: 25058.9 Da    PI: 8.6809
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g10900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS150.51.5e-4629167229374
              GRAS 229 klvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                       + +++ls kv+vv+eqe++hn++ + erf+eal+yy+alfd+le++ +r s er+ vEr llg+ei+n+vac g errerhe       rle 
  LOC_Os06g10900.1  29 ESLRGLSLKVMVVTEQEVSHNAAGLTERFVEALNYYAALFDCLEVGGARGSVERTRVERWLLGEEIKNIVACDGGERRERHE-------RLEG 114
                       57899****************************************************************************9.......999* PP

              GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       aGF+ vpls++a  qa+++ +  + dg++v ee+g ++l+W+dr+L+svSaWr
  LOC_Os06g10900.1 115 AGFGRVPLSYYALLQARRVAQGLGCDGFKVREEKGNFFLCWQDRALFSVSAWR 167
                       ****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098516.2191147IPR005202Transcription factor GRAS
PfamPF035145.2E-4429167IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MALTKEAERL DVPFQFNPVV SRLDALDVES LRGLSLKVMV VTEQEVSHNA AGLTERFVEA  60
LNYYAALFDC LEVGGARGSV ERTRVERWLL GEEIKNIVAC DGGERRERHE RLEGAGFGRV  120
PLSYYALLQA RRVAQGLGCD GFKVREEKGN FFLCWQDRAL FSVSAWRGRR FAALLPLPPS  180
TPLPCSRVIA TLLSSPPPPC SPLHPYCPER RERMKGEKKG KRE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2032167230375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.589821e-106callus| flower| leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g10900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g10900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0046870.0AP004687.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0021C04.
GenBankAP0034580.0AP003458.4 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0701E03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616256.14e-91PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 3
SwissprotQ9LPR81e-54SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A0N7KLR41e-137A0A0N7KLR4_ORYSJ; Os06g0211500 protein (Fragment)
STRINGLOC_Os06g10900.11e-161(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25641433
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-45scarecrow-like 3