PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g10600.1
Common NameGL2-8, LOC4340445, Os06g0208100, P0664C05.15, ROC8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 698aa    MW: 75491.7 Da    PI: 6.638
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g10600.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.3e-211671156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      r++ +++t+ q+++Le++F+++++p++++r++L+++lgL+ rq+k+WFqNrR+++k
  LOC_Os06g10600.1 16 RKRYHRHTPRQIQQLEAMFKECPHPDENQRAQLSRELGLEPRQIKFWFQNRRTQMK 71
                      688899***********************************************998 PP

2START1233.8e-392074542206
                       HHHHHHHHHHHHHHHC-TT-EEEE..........EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
             START   2 laeeaaqelvkkalaeepgWvkss..........esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                       +a +a++el+++a+a++  W+ks+          e +n d++ ++f++ ++       ++e +r+sg+v m ++ l   ++d++ +W e ++ 
  LOC_Os06g10600.1 207 MATRAMDELIRLAQAGDHIWSKSPgggvsggdarETLNVDTYDSIFSKPGGsyrapsINVEGSRESGLVLMSAVALADVFMDTN-KWMEFFPs 298
                       57899****************************999**********887779****99****************9999999999.******** PP

                       ...EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
             START  78 ...kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          ka t++v+ +g     + l lm+ el  ++p+vp R++ fvRy+rq ++g w+i+dvSvd +++    ++  R+++lpSg+li +++ng+
  LOC_Os06g10600.1 299 ivsKAHTIDVLVNGmggrsESLILMYEELHIMTPAVPtREVNFVRYCRQIEQGLWAIADVSVDLQRDAHFGAPPPRSRRLPSGCLIADMANGY 391
                       *******************************************************************98899********************* PP

                       ...........EEEEE......EE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 162 ...........skvtw......vehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                                    v+w      v h+ +++++p   l+r lv sg+a+ga +w+a+lqr ce+
  LOC_Os06g10600.1 392 skvyamdnvphAMVFWfrladdVAHARVEEKSPiNVLYRDLVLSGAAFGAHRWLAALQRACER 454
                       9999999999977777445555778889*****999*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-20976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-221078IPR009057Homeodomain-like
PROSITE profilePS5007118.2041373IPR001356Homeobox domain
SMARTSM003894.8E-201477IPR001356Homeobox domain
CDDcd000865.37E-201574No hitNo description
PfamPF000461.8E-181671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084839.918197457IPR002913START domain
SuperFamilySSF559611.65E-23198456No hitNo description
CDDcd088751.96E-102201453No hitNo description
SMARTSM002346.5E-23206454IPR002913START domain
PfamPF018521.3E-31207454IPR002913START domain
SuperFamilySSF559617.51E-15471618No hitNo description
SuperFamilySSF559617.51E-15646685No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MDFGDEPEGS DSQRRRKRYH RHTPRQIQQL EAMFKECPHP DENQRAQLSR ELGLEPRQIK  60
FWFQNRRTQM KAQHERADNC FLRAENDKIR CENIAIREAL KNVICPTCGG PPVGEDYFDE  120
QKLRMENARL KEELDRVSNL TSKYLGRPFT QLPPATPPMT VSSLDLSVGG MGGPSLDLDL  180
LSGGSSGIPF QLPAPVSDME RPMMAEMATR AMDELIRLAQ AGDHIWSKSP GGGVSGGDAR  240
ETLNVDTYDS IFSKPGGSYR APSINVEGSR ESGLVLMSAV ALADVFMDTN KWMEFFPSIV  300
SKAHTIDVLV NGMGGRSESL ILMYEELHIM TPAVPTREVN FVRYCRQIEQ GLWAIADVSV  360
DLQRDAHFGA PPPRSRRLPS GCLIADMANG YSKVYAMDNV PHAMVFWFRL ADDVAHARVE  420
EKSPINVLYR DLVLSGAAFG AHRWLAALQR ACERYASLVA LGVPHHIAGV TPEGKRSMMK  480
LSQRMVNSFC SSLGASQMHQ WTTLSGSNEV SVRVTMHRST DPGQPNGVVL SAATSIWLPV  540
PCDHVFAFVR DENTRSQGLN ASQNSMLILQ ESCTDASGSL VVYSPIDIPA ANVVMSGEDP  600
SSIPLLPSGF TILPDGRPGS AAGASTSSAG PLAAARGGGG GGAGGGSVVT VAFQILVSSL  660
PSSKLNAESV ATVNGLITTT VEQIKAALNC SAHGHHP*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO313391080.0
Expression AtlasQ69T58-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g10600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g10600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0047580.0AP004758.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0664C05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642098.10.0PREDICTED: homeobox-leucine zipper protein ROC8
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A0E0DYN50.0A0A0E0DYN5_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g10600.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11