PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g10350.1
Common NameLOC4340430, Os06g0205100, OSJNBb0015B15.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 272aa    MW: 28895.1 Da    PI: 7.2204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g10350.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT  Ed+ l+ ++k +G g W+ ++++ g++R++k+c++rw++yl
  LOC_Os06g10350.1 14 RGAWTSKEDDVLASYIKSHGEGKWREVPQRAGLRRCGKSCRLRWLNYL 61
                      89********************************************97 PP

2Myb_DNA-binding45.32e-1472110747
                       HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +++el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
  LOC_Os06g10350.1  72 DDEELIVRLHTLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 110
                       789*************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-22663IPR009057Homeodomain-like
PROSITE profilePS5129422.594965IPR017930Myb domain
SuperFamilySSF466893.75E-2611107IPR009057Homeodomain-like
SMARTSM007171.6E-111363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001672.46E-81661No hitNo description
Gene3DG3DSA:1.10.10.605.6E-2064115IPR009057Homeodomain-like
SMARTSM007175.4E-966113IPR001005SANT/Myb domain
PROSITE profilePS5129416.5666115IPR017930Myb domain
CDDcd001675.66E-971111No hitNo description
PfamPF002491.9E-1172110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRRACCAKE GMKRGAWTSK EDDVLASYIK SHGEGKWREV PQRAGLRRCG KSCRLRWLNY  60
LRPNIKRGNI DDDEELIVRL HTLLGNRWSL IAGRLPGRTD NEIKNYWNST LSRKIGTAAT  120
AAAGSRGGST PDTARATDAA SSSSVVPPGQ QQQPASRADT DTATAAAAAA ATTTTVWAPK  180
AVRCTRGFFF HDRETAPLAA AAPAPAGELG DGDDVDCDYY CSGSSSAATT TSSSSLPAVV  240
EPCFSAGDDW MDDVRALASF LDTDDAWNLC A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24121175110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.813670.0stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO41382980.0
Expression AtlasQ69NN9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g10350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g10350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3797030.0HQ379703.1 Oryza sativa Japonica Group isolate Z418-A C1 protein (C1) mRNA, complete cds.
GenBankY152190.0Y15219.1 Oryza sativa mRNA for transcriptional activator.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642631.10.0PREDICTED: anthocyanin regulatory C1 protein
SwissprotP102909e-87MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLQ69NN90.0Q69NN9_ORYSJ; Myb protein
STRINGLOC_Os06g10350.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.14e-56myb domain protein 7
Publications ? help Back to Top
  1. Gao D,He B,Zhou Y,Sun L
    Genetic and molecular analysis of a purple sheath somaclonal mutant in japonica rice.
    Plant Cell Rep., 2011. 30(5): p. 901-11
    [PMID:21249365]