PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g10310.1
Common NameGRF2, LOC107276671, Os06g0204800, OSJNBb0015B15.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 302aa    MW: 32227.9 Da    PI: 7.9544
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g10310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.82.2e-2487130144
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       d+epgrCrRtDGKkWRCsr++++ +k+CE+H+hrg++rsrk++e
  LOC_Os06g10310.1  87 DPEPGRCRRTDGKKWRCSREAYGESKYCEKHMHRGKNRSRKPVE 130
                       79***************************************997 PP

2QLQ62.61e-211145236
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                       FTa+Q+q+L++Q+l+yKy+aa++PvPp+Ll++++
  LOC_Os06g10310.1 11 LFTATQWQELEHQALIYKYMAAGAPVPPDLLLHLR 45
                      5******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-101046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.0391146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.0E-161244IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.71487131IPR014977WRC domain
PfamPF088791.5E-1988130IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MMAGGGSGRC LFTATQWQEL EHQALIYKYM AAGAPVPPDL LLHLRHRAAA AAAADVDTVP  60
SLAFPPHHLG WGCYGAAAAQ YGRRVEDPEP GRCRRTDGKK WRCSREAYGE SKYCEKHMHR  120
GKNRSRKPVE MPPPAAAAVY RPSALSISPP PHDADAPSYG AGAGAPLQLH LDSFHASTSP  180
PPSYHRYAHT SSAPLFPSSA AGYGGGWSLS KEHCLTLGGA AADLSLDKPA DHHHDATSAT  240
TEKPLRRFFD EWPRSDDGRT PWDGTQLSIS IPTAAAASPD LAIAGAASRY HSNGDHLRTS  300
E*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6AWY7
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g10310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g10310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8361980.0CT836198.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA059E01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641768.10.0PREDICTED: growth-regulating factor 2
SwissprotQ6AWY70.0GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLA0A0E0A6H40.0A0A0E0A6H4_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g10310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-42growth-regulating factor 5
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]