PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g09660.1
Common NameARF16, LOC9270361, Os06g0196700, OsJ_019622
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 1056aa    MW: 116861 Da    PI: 6.5963
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g09660.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.4e-23127228199
                       EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                       f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   +
  LOC_Os06g09660.1 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELIAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI--R 215
                       99*****************************96555444..8************************************************..4 PP

                       SSEE..EEEEE-S CS
                B3  87 rsefelvvkvfrk 99 
                       +++ +l+++++r+
  LOC_Os06g09660.1 216 DEKSQLLLGIRRA 228
                       5677789999997 PP

2Auxin_resp122.92.3e-40253335183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldpvrW+nS+Wr+L+
  LOC_Os06g09660.1 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ 335
                       79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-40119242IPR015300DNA-binding pseudobarrel domain
CDDcd100175.46E-20126227No hitNo description
SMARTSM010195.1E-23127229IPR003340B3 DNA binding domain
PfamPF023625.0E-21127228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.224127229IPR003340B3 DNA binding domain
PfamPF065073.8E-35253335IPR010525Auxin response factor
PfamPF023097.9E-99371026IPR033389AUX/IAA domain
PROSITE profilePS5174524.4739401024IPR000270PB1 domain
SuperFamilySSF542773.83E-79581019No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001013developmental stageH late unicellular microspore stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 1056 aa     Download sequence    Send to blast
MKDQGSSGVS PAPGEGEKKA INSELWHACA GPLVSLPPVG SLVVYFPQGH SEQVAASMHK  60
ELDNIPGYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVNKYDRDAM LASELGLKQN  120
KQPAEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFTM QPPAQELIAK DLHDISWKFR  180
HIYRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRRATR PQPALSSSVL  240
SSDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITGIGD LDPVRWKNSH WRNLQVGWDE STASERRTRV SIWEIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDENEVESA FKRAMPWLAD DFALKDVQSA LFPGLSLVQW  420
MAMQQNPQML TAASQTVQSP YLNSNALAMQ DVMGSSNEDP TKRLNTQAQN MVLPNLQVGS  480
KVDHPVMSQH QQQPHQLSQQ QQVQPSQQSS VVLQQHQAQL LQQNAIHLQQ QQEHLQRQQS  540
QPAQQLKAAS SLHSVEQHKL KEQTSGGQVA SQAQMLNQIF PPSSSQLQQL GLPKSPTHRQ  600
GLTGLPIAGS LQQPTLTQTS QVQQAAEYQQ ALLQSQQQQQ QLQLQQLSQP EVQLQLLQKI  660
QQQNMLSQLN PQHQSQLIQQ LSQKSQEILQ QQILQHQFGG SDSIGQLKQS PSQQAPLNHM  720
TGSLTPQQLV RSHSALAESG DPSSSTAPST SRISPINSLS RANQGSRNLT DMVATPQIDN  780
LLQEIQSKPD NRIKNDIQSK ETVPIHNRHP VSDQLDASSA TSFCLDESPR EGFSFPPVCL  840
DNNVQVDPRD NFLIAENVDA LMPDALLSRG MASGKGMCTL TSGQRDHRDV ENELSSAAFS  900
SQSFGVPDMS FKPGCSSDVA VTDAGMPSQG LWNNQTQRMR TFTKVQKRGS VGRSIDITRY  960
RDYDELRHDL ACMFGIQGQL EDPYRMDWKL VYVDHENDIL LVGDDPWEEF VGCVKSIKIL  1020
SAAEVQQMSL DGDLGGVPPQ TQACSASDDA NAWRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1651735647388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.229170.0callus| flower| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329885360.0
Expression AtlasA3B9A0-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g09660.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g09660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1033270.0AK103327.1 Oryza sativa Japonica Group cDNA clone:J033125L14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643020.10.0PREDICTED: auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLA0A0E0PUN50.0A0A0E0PUN5_ORYRU; Auxin response factor
STRINGLOC_Os06g09660.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9033914
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Wang D, et al.
    Genome-wide analysis of the auxin response factors (ARF) gene family in rice (Oryza sativa).
    Gene, 2007. 394(1-2): p. 13-24
    [PMID:17408882]