PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g08440.1
Common NameLOC4340320, ORR2, Os06g0183100, OsJ_20357, OSJNBb0036B04.15, RR22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 697aa    MW: 75949.6 Da    PI: 6.4229
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g08440.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like902.1e-28217270155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  LOC_Os06g08440.1 217 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKRILELMNVEKLTRENVASHLQKYRL 270
                       79*******************.********************************8 PP

2Response_reg76.41.1e-25281361109
                       EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
      Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                       vl vdD+p+ +++l+++l++ +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge +++ + + 
  LOC_Os06g08440.1  28 VLAVDDDPVCLKVLETLLRRCQY-HVTSTNQAITALKLLRENRdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKTVMKGIT 118
                       799********************.***************99999********************87754.558******************** PP

                       TTESEEEESS--HHHHHH CS
      Response_reg  92 aGakdflsKpfdpeelvk 109
                        Ga d+l Kp+ +eel++
  LOC_Os06g08440.1 119 HGACDYLLKPVRIEELRN 136
                       ****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363929.5E-2195696IPR017053Response regulator B-type, plant
SuperFamilySSF521721.41E-3425152IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.4E-4125154No hitNo description
SMARTSM004483.8E-3026138IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.27527142IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.2E-2328137IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.95E-2529141No hitNo description
PROSITE profilePS5129411.351214273IPR017930Myb domain
SuperFamilySSF466891.68E-19215274IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-30215275IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25217270IPR006447Myb domain, plants
PfamPF002491.3E-6219269IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MLLGALRMEE RKGLMGRERD QFPVGMRVLA VDDDPVCLKV LETLLRRCQY HVTSTNQAIT  60
ALKLLRENRD MFDLVISDVH MPDMDGFKLL ELVGLEMDLP VIMLSVNGET KTVMKGITHG  120
ACDYLLKPVR IEELRNIWQH VVRRKFGNRE RNNLDFSKEC NKPQSADTDH GPYQPTCGSS  180
DQNGRSSRKR KELHGEDDDE GDDNDYQEND EPSAAKKPRV VWSVELHRKF VAAVNQLGID  240
KAVPKRILEL MNVEKLTREN VASHLQKYRL YLKRLGAVAS QQASIVAAFG GRDPSFLHIG  300
AFEGLQSYQP FAPSAALPSF NPHGLLTRTS AAAAFGLQEL AAPSSTIQTS TGNVTVGHCL  360
EENQQANLAQ GLTAAIGQPQ LQQNWIHQEG NGLSDVFSGS SLTNTLSSTL QRVPSSSLPP  420
QELLECKQAK VSMPPSIRIP PSSSALLERT LGVSTNLGDS SISQQGALPI DGGFSADRLP  480
LHSSFDGAVA TKLDTSLAAS QREIGQQGKF SVSMLVSPSD NLALAKNAKT GASSSGSTII  540
LPLDTARHSD YLQFGGASNS LQKMDGQKQD HIQSSNIIWS SMPSTQLPSD TQIHNTQNQR  600
LDSGSFNHNI GAHLADQTNA SASILPQMKF DTRISEEKMK QKNTYDLGSS KLQGGFNSSG  660
CNFDGLLNSI IKVEKDDLPF MDNELGCDLF PLGACI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-24213275163ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878720.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154667730.0
Expression AtlasQ5SML5-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g08440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Dwarf, narrow leaf, lesion mimic, low tillering, late heading and low fertility phenotypes. {ECO:0000269|PubMed:16891544}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g08440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029590.0AK102959.1 Oryza sativa Japonica Group cDNA clone:J033115H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640894.10.0PREDICTED: two-component response regulator ORR22
SwissprotQ5SML50.0ORR22_ORYSJ; Two-component response regulator ORR22
TrEMBLA0A0E0PUC00.0A0A0E0PUC0_ORYRU; Uncharacterized protein
STRINGLOC_Os06g08440.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
MonocotsOGMP18563894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-109response regulator 12
Publications ? help Back to Top
  1. Pareek A, et al.
    Whole-genome analysis of Oryza sativa reveals similar architecture of two-component signaling machinery with Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 380-97
    [PMID:16891544]
  2. Ito Y,Kurata N
    Identification and characterization of cytokinin-signalling gene families in rice.
    Gene, 2006. 382: p. 57-65
    [PMID:16919402]
  3. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]
  4. Tsai YC, et al.
    Characterization of genes involved in cytokinin signaling and metabolism from rice.
    Plant Physiol., 2012. 158(4): p. 1666-84
    [PMID:22383541]