PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g07650.1
Common NameLOC107281372, OSJNBa0014B15.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 395aa    MW: 43314.9 Da    PI: 4.4297
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g07650.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.21.4e-11184229247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         WTteE+ +++++ + +G g Wk+I+  +   +t+ q+ s+ qky
  LOC_Os06g07650.1 184 RFWTTEEHRQFLRGLRVYGRGEWKSISMNFVRSKTPVQVSSHAQKY 229
                       56*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.601178234IPR017930Myb domain
SuperFamilySSF466893.29E-15180235IPR009057Homeodomain-like
SMARTSM007171.4E-9182232IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-9183231IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-13183232IPR006447Myb domain, plants
CDDcd001672.40E-8186230No hitNo description
PfamPF002492.8E-8186229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MEWTAAEMDE ARSIIARLTN AYDSGTLVAG AGNGDTRHDR IVRELQAWLP WRTMDQLIGL  60
YIELMAEEPA AAQPQYFDAG AVVDPTFDFF NDHNNFLGMP PPPVQQADDH NMNNVVADAG  120
MNYYYGGGGA GGAMVFGGAP MGETVEQAAP PVPVVPVVMN RDDDEVNNQG GGRHRAAPTN  180
TTRRFWTTEE HRQFLRGLRV YGRGEWKSIS MNFVRSKTPV QVSSHAQKYF RRVESAAADK  240
QRYSINDVGL NDDTAAMDGT NSYSNNNFGG WQSLAFAGGH LEPVSGGGAA RQVIAPASSS  300
AAAMNSAAQF WAPMLFNPQI QQQFMQMQAQ TQQAWNDQHM MMAAAPMEGA TDTNFEPAGA  360
VNYYYYQQQQ EEEEGGAYGV PADQWMMNQN NNMC*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5SNB8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g07650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g07650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0028540.0AP002854.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0014B15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642794.10.0PREDICTED: uncharacterized protein LOC107281372
TrEMBLA2Y9V90.0A2Y9V9_ORYSI; Putative uncharacterized protein
TrEMBLQ5SNB80.0Q5SNB8_ORYSJ; One repeat myb transcriptional factor-like
STRINGBGIOSGA021812-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g07650.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.23e-21MYB family protein