PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g07640.1
Common NameLOC107281238, OSJNBa0014B15.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 322aa    MW: 35244.3 Da    PI: 9.0757
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g07640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.99.8e-13177221347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        WT+eE+ l+  + + +G g+Wk I++++ ++Rt+ q+ s+ qk+
  LOC_Os06g07640.1 177 IWTEEEHRLFMVGLRVFGRGDWKNISKHLVTTRTAAQVSSHAQKF 221
                       6******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.372169226IPR017930Myb domain
SuperFamilySSF466897.9E-17172226IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-9173220IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-14173224IPR006447Myb domain, plants
SMARTSM007178.1E-9174224IPR001005SANT/Myb domain
CDDcd001673.45E-8178222No hitNo description
PfamPF002491.2E-9178220IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGSIVIEGWT ASEIEEARSL ITSPNNGGEG GDGEGNKQKH CGHIVMELHE WFPWKTIGQV  60
IGLYMKLNAG KPMVMHSLNK SDANNSIGEV DHVSALANGN PVRLEEHRPM LNNVGLVFDY  120
PLEEMEMENQ TDQEPKMVVE EEVQPKEGLV IKEKEAGVSK IHTNSQHVTP SIKRRVIWTE  180
EEHRLFMVGL RVFGRGDWKN ISKHLVTTRT AAQVSSHAQK FFLKMEARGE AVPPPAKRRR  240
RRITGDQQAA AAEHAAALRR RMPVPPPPFN PFLLPSLVAP VMHRLLPPGS QAAGAAASGS  300
GGQGASLPQM PWINGANGMG R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1236241KRRRRR
2236242KRRRRRI
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5SNB9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g07640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g07640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0028540.0AP002854.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0014B15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642214.10.0PREDICTED: uncharacterized protein LOC107281238
TrEMBLQ5SNB90.0Q5SNB9_ORYSJ; Putative uncharacterized protein
TrEMBLA2Y9V80.0A2Y9V8_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0HPY90.0A0A0E0HPY9_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PU550.0A0A0E0PU55_ORYRU; Uncharacterized protein
STRINGBGIOSGA021813-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g07640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1230136
MonocotsOGMP165491112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-18Homeodomain-like transcriptional regulator