PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g07010.2
Common NameLOC4340242, Os06g0166100, OSJNBa0015I14.33, OSNPB_060166100, P0680A03.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 781aa    MW: 88521.3 Da    PI: 7.3517
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g07010.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR171.12.6e-2254140290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        Y++Y++++GFsvrk k+++   +++i +++++Cskeg + +e  +  +++ +r+ trt+Cka+++ + +++g+w v++++  HnH+la
  LOC_Os06g07010.2  54 LYCDYGHRIGFSVRKGKQSYFIGTKNIRTKDYYCSKEGLKYDEPVT--EANFNRPDTRTNCKAMIRFRVDEKGRWTVIRFVPTHNHQLA 140
                       7********************9*******************99988..9999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.5E-2054140IPR004330FAR1 DNA binding domain
PfamPF105514.1E-31262355IPR018289MULE transposase domain
PROSITE profilePS509669.186543579IPR007527Zinc finger, SWIM-type
PfamPF044344.2E-6544576IPR007527Zinc finger, SWIM-type
SMARTSM005756.0E-6554581IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MDSSRDSEEE RPQRKDNGEE TENGEDGGNA LSLKDVANEL LGCVVHSEEE AYKLYCDYGH  60
RIGFSVRKGK QSYFIGTKNI RTKDYYCSKE GLKYDEPVTE ANFNRPDTRT NCKAMIRFRV  120
DEKGRWTVIR FVPTHNHQLA KPGERHMLRS AKSLAVGKSG VIDPQASTES HPINGFSHMI  180
GSDIVEPPGY TIRDCYNHVS MQGITIIEAG DSQSLVNYFK RRTNEEGMFY WDVQVDQEGR  240
MTNFFFRDAK SRNDFDCFGD AVIFDTTFRT NKYSLVCAPF VGVNHHWQNI VFGCAFLLDE  300
SSASYVWLFK SFLESMGGRS PKSIFTDQDD AITQAVELVF PNTQHCFSYW HILKNAQSHL  360
GTVNTSQTFQ NMFIKCMQGP NSETELEESW ATMLNEYKLQ ENSWLSDLYR SRNKWCSAFN  420
KDTFDGGINS SQWGEVSNNT FTGISDESTP LTRFALLLEK VFKGLRRNES EEDFRCSQTA  480
PVRAIKHSTV LKQAAESYTH KIYKLFEAEF LDGCGATSCH ESSCGGNLLR FEITMQGRGS  540
KVWTVLLDTS TMEISCGCRK FERMGLLCSH ALKAFSLQNV DTIPEKYISK RWTKDARRSM  600
YKLSQDDSTQ QECTEAELAY RNRATQYACS LIAKSQELDE SRKIFWDTLE TGEKALDVFF  660
EIRSLRSQAA KDVSKRDKKK KKSSKGPSTK KAKPTPATSS AVPELLAQTN VHQFQSAQDA  720
QGNTTIGRPL YYQAFSSAPI QPNQIYMHPN MHTMPLCAPQ DFSAYSAMRP NSNFGGAKNV  780
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.252990.0flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329761920.0
Expression AtlasQ5VRR4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g07010.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g07010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0661740.0AK066174.1 Oryza sativa Japonica Group cDNA clone:J013056I21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643629.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X2
TrEMBLQ5VRR40.0Q5VRR4_ORYSJ; Os06g0166100 protein
STRINGBGIOSGA022378-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-103FAR1-related sequence 5