PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g06750.1
Common NameLOC4340218, MADS5, Os06g0162800, OsJ_019405, P0681F10.39
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 25993.6 Da    PI: 7.464
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g06750.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.41e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++g+l+e+s+
  LOC_Os06g06750.1  9 KRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFST 59
                      79***********************************************96 PP

2K-box91.41.6e-308717512100
             K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       +++ s +qe+ kLk ++e Lq++qR+llGedL +LslkeL+qLe+q+e sl +iRs Kn+ ll+q+ el++ke++lq++nk+L++k++e
  LOC_Os06g06750.1  87 ETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQE 175
                       44567899*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.039161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-32276IPR002100Transcription factor, MADS-box
CDDcd002655.12E-42276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.15389179IPR002487Transcription factor, K-box
PfamPF014863.8E-2592174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFST RGRLFEFSTS  60
SCMYKTLERY RSCNYNLNSC EASAALETEL SNYQEYLKLK TRVEFLQTTQ RNLLGEDLVP  120
LSLKELEQLE NQIEISLMNI RSSKNQQLLD QVFELKRKEQ QLQDANKDLK RKIQETSGEN  180
MLHISCQDVG PSGHASEANQ EFLHHAICDP SLHIGYQAYM DHLNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D4e-22701731101Developmental protein SEPALLATA 3
4ox0_C4e-22701731101Developmental protein SEPALLATA 3
4ox0_B4e-22701731101Developmental protein SEPALLATA 3
4ox0_A4e-22701731101Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.43670.0callus| flower| panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0DEB8
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in anthers. Weakly expressed in carpels. {ECO:0000269|PubMed:9085264}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:16217607, ECO:0000269|PubMed:9085264, ECO:0000269|Ref.8}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g06750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q0DEB8
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g06750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0641840.0AK064184.1 Oryza sativa Japonica Group cDNA clone:002-104-B10, full insert sequence.
GenBankOSU788900.0U78890.1 Oryza sativa MADS box protein (OsMADS5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641896.11e-166PREDICTED: MADS-box transcription factor 5
SwissprotA2Y9P01e-168MADS5_ORYSI; MADS-box transcription factor 5
SwissprotQ0DEB81e-168MADS5_ORYSJ; MADS-box transcription factor 5
TrEMBLA0A0E0HLJ31e-166A0A0E0HLJ3_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PTW61e-166A0A0E0PTW6_ORYRU; Uncharacterized protein
STRINGLOC_Os06g06750.11e-166(Oryza sativa Japonica Group)
STRINGBGIOSGA021849-PA1e-166(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP22213264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.26e-76MIKC_MADS family protein
Publications ? help Back to Top
  1. Moon YH, et al.
    Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
    Plant Physiol., 1999. 120(4): p. 1193-204
    [PMID:10444103]
  2. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  3. Agrawal GK,Abe K,Yamazaki M,Miyao A,Hirochika H
    Conservation of the E-function for floral organ identity in rice revealed by the analysis of tissue culture-induced loss-of-function mutants of the OsMADS1 gene.
    Plant Mol. Biol., 2005. 59(1): p. 125-35
    [PMID:16217607]
  4. Kang HG,An G
    Isolation and characterization of a rice MADS box gene belonging to the AGL2 gene family.
    Mol. Cells, 1997. 7(1): p. 45-51
    [PMID:9085264]