PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g06740.1
Common NameLOC9270835
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 325aa    MW: 36959.7 Da    PI: 7.308
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g06740.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.1e-182369148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g WT eEd +lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  LOC_Os06g06740.1 23 KGQWTLEEDRKLVKLVEQFGLRKWSHIAQILP-GRVGKQCRERWHNHL 69
                      799*****************************.*************97 PP

2Myb_DNA-binding52.31.3e-1675117145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  LOC_Os06g06740.1  75 KDTWSEEEDIVLIQTHKEVGNK-WAEIAKHLP-GRTENSIKNHWN 117
                       679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.591873IPR017930Myb domain
SuperFamilySSF466895.39E-3220116IPR009057Homeodomain-like
SMARTSM007171.6E-152271IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-282476IPR009057Homeodomain-like
PfamPF139212.8E-202685No hitNo description
CDDcd001676.27E-152669No hitNo description
PROSITE profilePS5129421.24974124IPR017930Myb domain
SMARTSM007171.3E-1574122IPR001005SANT/Myb domain
CDDcd001675.91E-1277120No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2277122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MNSRLIRRKR ASGKSLKKAN VVKGQWTLEE DRKLVKLVEQ FGLRKWSHIA QILPGRVGKQ  60
CRERWHNHLR PNIKKDTWSE EEDIVLIQTH KEVGNKWAEI AKHLPGRTEN SIKNHWNATK  120
RRQFARRRSR ASSKNPKSGT LLQNYIKSLG IGPIKSSVRQ APPESTAVSS SSPASTQKLA  180
EVNGKIRPDS NPSNQMVTQG ILTMDENSYI QTNSCEELLV STYDDLCLDM CDHLFETKDE  240
MPYQVYNIDD DVDMNYIFNH IDYANKIGHE IDMEMAWDDD VLQDDESAGS SPLETPAGLA  300
QINTVHVKEE MDLIEMVTRT QSCG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-44211242105C-Myb DNA-Binding Domain
1msf_C2e-44211242105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.775320.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977245020.0
Expression AtlasB7F923-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g06740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g06740
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2418120.0AK241812.1 Oryza sativa Japonica Group cDNA, clone: J065210K15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641270.10.0PREDICTED: myb protein isoform X2
TrEMBLB7F9230.0B7F923_ORYSJ; cDNA, clone: J065210K15, full insert sequence
STRINGLOC_Os06g06740.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.18e-66myb domain protein 98