PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g05890.1
Common NameLOC4340156, Os06g0152200, OsJ_20154, OSNPB_060152200, P0529C07.33, P0710H01.45
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 361aa    MW: 38395.7 Da    PI: 5.1743
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g05890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.35.5e-07447542
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       C+ ++  e++  C  ++  lC  C +e H        H++vpl
  LOC_Os06g05890.1  4 QCNACGAAEARVLCCADEAALCTACDEEVHAAnklagkHQRVPL 47
                      7******99*********************66899999999986 PP

2zf-B_box29.81.2e-096395335
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                       +kC+ ++e    +fC +++ llC+dC +++H 
  LOC_Os06g05890.1 63 VPKCDICQEASGYFFCLEDRALLCRDCDVSIHT 95
                      589*****************************3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.722147IPR000315B-box-type zinc finger
CDDcd000211.07E-8347No hitNo description
PfamPF006432.7E-5447IPR000315B-box-type zinc finger
SMARTSM003363.0E-9447IPR000315B-box-type zinc finger
SMARTSM003365.0E-1661108IPR000315B-box-type zinc finger
CDDcd000211.00E-964108No hitNo description
PfamPF006431.8E-76495IPR000315B-box-type zinc finger
PROSITE profilePS501198.71766108IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0009658Biological Processchloroplast organization
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010099Biological Processregulation of photomorphogenesis
GO:0015995Biological Processchlorophyll biosynthetic process
GO:0016607Cellular Componentnuclear speck
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MKIQCNACGA AEARVLCCAD EAALCTACDE EVHAANKLAG KHQRVPLLSD DGGAAPAAAA  60
PAVPKCDICQ EASGYFFCLE DRALLCRDCD VSIHTVNSFV SVHQRFLLTG VQVGLDPADP  120
VPPVADKHVK SAGGSVDSAT KHLQRNPTDL SGENSASLPS QNVINGNYSR QSSVTMAKTG  180
QVNWTMSNNT IRSIDPPPKY SSEESPALLL ASHTSTMAAY SSQISKDSDR IYNLPFTGGN  240
GSDSLHDWHV DEFFSNSEFG FAEHGSSKGD NAKPGSAGGS PQCRLAEGLF VEGLLGQVPD  300
NPWTVPEVPS PPTASGLYWQ NNLLCPSYDS TMFVPEISSL ENSQNNFTVS AGLKRRRRQF  360
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.33980.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329822540.0
Expression AtlasO82116-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g05890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g05890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0018860.0AB001886.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:R2931.
GenBankAK1040830.0AK104083.1 Oryza sativa Japonica Group cDNA clone:001-029-D01, full insert sequence.
GenBankAK0722310.0AK072231.1 Oryza sativa Japonica Group cDNA clone:J023001E21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644333.10.0PREDICTED: B-box zinc finger protein 22
TrEMBLA2Y9G20.0A2Y9G2_ORYSI; Putative uncharacterized protein
TrEMBLO821160.0O82116_ORYSJ; Os06g0152200 protein
STRINGLOC_Os06g05890.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA022334-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18041634
MonocotsOGMP17943382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.12e-55light-regulated zinc finger protein 1
Publications ? help Back to Top
  1. Song J, et al.
    Isolation and mapping of a family of putative zinc-finger protein cDNAs from rice.
    DNA Res., 1998. 5(2): p. 95-101
    [PMID:9679197]