PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g04090.1
Common Name134P10.2, LOC4340011, Os06g0131700, OSNPB_060131700, P0493C11.25-1, P0679C08.7-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 396aa    MW: 42026.9 Da    PI: 7.0686
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g04090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.8e-53111391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk
  LOC_Os06g04090.1  11 VPPGFRFHPTEEELLTYYLKKKVASERIDL-DVIRDVDLNKLEPWDIQErcRIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDK 102
                       69****************************.9***************953444443456********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl
  LOC_Os06g04090.1 103 AIYS-SSNRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                       ****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-577149IPR003441NAC domain
PROSITE profilePS5100555.85811189IPR003441NAC domain
PfamPF023656.5E-2812139IPR003441NAC domain
SuperFamilySSF1019414.18E-57177189IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MSISVNGQSV VPPGFRFHPT EEELLTYYLK KKVASERIDL DVIRDVDLNK LEPWDIQERC  60
RIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYSSSNR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DPSSASASVS VNLPSYYSSS SSSSSPMHGV AGDQGAQEEG  180
WVICRVFKKK NLVHHGGGAA AASHHAAAKL AAAAMEGSPS NCSTVTVSDH VKAQMLHSSA  240
SDDALDHILQ YMGRSGCKQE TKPAAMSASS AAAAAALEQH LSTPQYGKFM KLPPLEHVAG  300
GVGLLAAAGG GGEYCSAADA SGIADWDTLD RLAASYELNG ALSDVASGKN MAGFFDVVDQ  360
PAGAAAFSSG DGDLWSLARS VSSSLHADLT TMNNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-48819114167NAC domain-containing protein 19
4dul_A6e-48819114167NAC domain-containing protein 19
1ut7_B6e-48819114167NO APICAL MERISTEM PROTEIN
1ut7_A6e-48819114167NO APICAL MERISTEM PROTEIN
1ut4_B6e-48819114167NO APICAL MERISTEM PROTEIN
1ut4_A6e-48819114167NO APICAL MERISTEM PROTEIN
3swp_D7e-48819117170NAC domain-containing protein 19
3swp_C7e-48819117170NAC domain-containing protein 19
3swp_B7e-48819117170NAC domain-containing protein 19
3swp_A7e-48819117170NAC domain-containing protein 19
3swm_D7e-48819117170NAC domain-containing protein 19
3swm_C7e-48819117170NAC domain-containing protein 19
3swm_B7e-48819117170NAC domain-containing protein 19
3swm_A7e-48819117170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.500540.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166333210.0
Expression AtlasQ9SNM6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g04090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g04090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6340700.0JN634070.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 1 mRNA, complete cds.
GenBankAK1197840.0AK119784.1 Oryza sativa Japonica Group cDNA clone:002-173-F05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643041.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-108NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0E0PT130.0A0A0E0PT13_ORYRU; Uncharacterized protein
TrEMBLA2Y8W50.0A2Y8W5_ORYSI; Putative uncharacterized protein
TrEMBLI1PZ860.0I1PZ86_ORYGL; Uncharacterized protein
TrEMBLQ9SNM60.0Q9SNM6_ORYSJ; Os06g0131700 protein
STRINGLOC_Os06g04090.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA022006-PA0.0(Oryza sativa Indica Group)
STRINGORGLA06G0019800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.12e-90NAC family protein
Publications ? help Back to Top
  1. Zhong R, et al.
    Transcriptional activation of secondary wall biosynthesis by rice and maize NAC and MYB transcription factors.
    Plant Cell Physiol., 2011. 52(10): p. 1856-71
    [PMID:21908441]