PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g04010.2
Common NameLOC4340004, Os06g0130600, P0493C11.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BBR-BPC
Protein Properties Length: 332aa    MW: 36612.3 Da    PI: 10.1229
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g04010.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind405.66.2e-12413311301
         GAGA_bind   1 mdddgsre..rnkg.yye..........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnk 80 
                       md+ g+re  r+++ +y+           +++lk++++++l++++++rd++irer++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+
  LOC_Os06g04010.2   1 MDNLGHREngRQRPdQYKglhtqwmmpqTQRHLKDHQSMNLLALMNDRDNAIRERDHALAEKKAAIAERDMAFTQRDAAMAERNAAVVERDNA 93 
                       9999999999****9***********74449************************************************************** PP

         GAGA_bind  81 llalllvensla...salpvgvqvlsgtksidslqqlse.....pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekka 164
                       l+al+l++++     + +++ +++lsg+k+i++++qls+      ql+ds+++ +re++++ea+pi++a+ +a ++k++kk++++++p+++ +
  LOC_Os06g04010.2  94 LAALELARTNGLnmnNGNGFPQGSLSGSKNIHHHDQLSHaqsspLQLADSPYDhAREMHISEAYPISTAPGSAGKAKRPKKNSSQASPLKRPS 186
                       ****99888765566889999***************888899999********9*************************************99 PP

         GAGA_bind 165 k..kkkkksekskkkvkkesader......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstk 249
                          +k+kk++ ++k+v ++++ ++      +k+e+k+++l+ln+v++D+st+P+P+CsCtG+lrqCYkWGnGGWqS+CCt++iS+yPLPv+++
  LOC_Os06g04010.2 187 GvlRKTKKPSGDWKNVGMSGCGDDsahasvMKNEWKDQNLGLNQVAFDDSTMPAPACSCTGKLRQCYKWGNGGWQSSCCTMNISMYPLPVMPN 279
                       988888889**********99855589999*************************************************************** PP

         GAGA_bind 250 rrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       +r+aR++grKmS+gaf+klL++LaaeG+dls+pvDLkdhWAkHGtn+++tir
  LOC_Os06g04010.2 280 KRHARMGGRKMSGGAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRYITIR 331
                       ***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062172.5E-971331IPR010409GAGA-binding transcriptional activator
SMARTSM012264.6E-1821331IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MDNLGHRENG RQRPDQYKGL HTQWMMPQTQ RHLKDHQSMN LLALMNDRDN AIRERDHALA  60
EKKAAIAERD MAFTQRDAAM AERNAAVVER DNALAALELA RTNGLNMNNG NGFPQGSLSG  120
SKNIHHHDQL SHAQSSPLQL ADSPYDHARE MHISEAYPIS TAPGSAGKAK RPKKNSSQAS  180
PLKRPSGVLR KTKKPSGDWK NVGMSGCGDD SAHASVMKNE WKDQNLGLNQ VAFDDSTMPA  240
PACSCTGKLR QCYKWGNGGW QSSCCTMNIS MYPLPVMPNK RHARMGGRKM SGGAFTKLLS  300
RLAAEGHDLS TPVDLKDHWA KHGTNRYITI R*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.105750.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329806400.0
Expression AtlasQ5VSA8-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g04010.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g04010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9575050.0AY957505.1 Oryza sativa (japonica cultivar-group) barley B recombinant-like protein D mRNA, complete cds.
GenBankAK0706160.0AK070616.1 Oryza sativa Japonica Group cDNA clone:J023060O20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641154.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_015641153.10.0PREDICTED: barley B recombinant-like protein D
SwissprotQ5VSA80.0BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLA0A0D3GCC30.0A0A0D3GCC3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0A4I00.0A0A0E0A4I0_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HKD40.0A0A0E0HKD4_ORYNI; Uncharacterized protein
TrEMBLI1PZ790.0I1PZ79_ORYGL; Uncharacterized protein
STRINGLOC_Os06g04010.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-100basic pentacysteine 6
Publications ? help Back to Top
  1. Santi L, et al.
    The GA octodinucleotide repeat binding factor BBR participates in the transcriptional regulation of the homeobox gene Bkn3.
    Plant J., 2003. 34(6): p. 813-26
    [PMID:12795701]
  2. Wanke D, et al.
    Alanine zipper-like coiled-coil domains are necessary for homotypic dimerization of plant GAGA-factors in the nucleus and nucleolus.
    PLoS ONE, 2011. 6(2): p. e16070
    [PMID:21347358]