PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g02560.3
Common NameGRF5, LOC4339928, Os06g0116200, OSJNBa0019F11.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 349aa    MW: 37815 Da    PI: 8.5629
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g02560.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.41.5e-2497141145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  LOC_Os06g02560.3  97 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 141
                       79****************************************986 PP

2QLQ58.22.5e-202458236
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                       FTaaQ+++L++Q+l+yKyL+a++PvP +Ll++i+
  LOC_Os06g02560.3 24 VFTAAQWAELEQQALIYKYLVAGVPVPGDLLLPIR 58
                      5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.6E-102359IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1872459IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.6E-142558IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.34697141IPR014977WRC domain
PfamPF088794.0E-2198140IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MLSSSPSAAA PGIGGYQPQR GAAVFTAAQW AELEQQALIY KYLVAGVPVP GDLLLPIRPH  60
SSAAATYSFA NPAAAPFYHH HHHPSLSYYA YYGKKLDPEP WRCRRTDGKK WRCSKEAHPD  120
SKYCERHMHR GRNRSRKPVE SKTAAPAPQS QPQLSNVTTA THDTDAPLPS LTVGAKTHGL  180
SLGGAGSSQF HVDAPSYGSK YSLGAKADVG ELSFFSGASG NTRGFTIDSP TDSSWHSLPS  240
SVPPYPMSKP RDSGLLPGAY SYSHLEPSQE LGQVTIASLS QEQERRSFGG GAGGMLGNVK  300
HENQPLRPFF DEWPGRRDSW SEMDEERSNQ TSFSTTQLSI SIPMPRCD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.326180.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329887170.0
Expression AtlasQ6AWY4-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g02560.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g02560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1035080.0AK103508.1 Oryza sativa Japonica Group cDNA clone:J033131E19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641605.10.0PREDICTED: growth-regulating factor 5 isoform X4
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLA0A0E0HK310.0A0A0E0HK31_ORYNI; Uncharacterized protein
TrEMBLB8B1M90.0B8B1M9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA022056-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-26growth-regulating factor 5
Publications ? help Back to Top
  1. Ye R,Yao QH,Xu ZH,Xue HW
    Development of an efficient method for the isolation of factors involved in gene transcription during rice embryo development.
    Plant J., 2004. 38(2): p. 348-57
    [PMID:15078336]
  2. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]