PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g02250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 368aa    MW: 39053.1 Da    PI: 5.8545
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g02250.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+llv+++ + G g+W++ ++  g++R++k+c++rw +yl
  LOC_Os06g02250.1 15 KGPWTPEEDKLLVEYIGKNGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                      79********************************************97 PP

2Myb_DNA-binding48.32.4e-1568113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg ++ +E+ l++++++ lG++ W++Ia ++  gRt++++k++w+++l
  LOC_Os06g02250.1  68 RGGFSDDEERLIIHLHATLGNK-WSSIATKLK-GRTDNEIKNYWNTHL 113
                       7889******************.********9.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23765IPR009057Homeodomain-like
PROSITE profilePS5129419.151062IPR017930Myb domain
SuperFamilySSF466892.57E-2912109IPR009057Homeodomain-like
SMARTSM007172.1E-141464IPR001005SANT/Myb domain
PfamPF002492.0E-161562IPR001005SANT/Myb domain
CDDcd001673.15E-111762No hitNo description
PROSITE profilePS5129425.78563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2566117IPR009057Homeodomain-like
SMARTSM007171.1E-1467115IPR001005SANT/Myb domain
PfamPF002493.3E-1468113IPR001005SANT/Myb domain
CDDcd001671.84E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRSPCCEQD ADVKKGPWTP EEDKLLVEYI GKNGHGSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGG FSDDEERLII HLHATLGNKW SSIATKLKGR TDNEIKNYWN THLRKKLLSQ  120
GIDPVTHRPR TDLLAGLPNL LAAANLGGAA HQLPLDLNAI KLQADAAKFQ ILQGLLRVLA  180
STTAPPPTAA VLPGTDLMTS ILGATLAANS AGILGQQQQL AGVDLSRLGQ YNGNYDNLPP  240
LTNDSCTQQT QPAMSSMSPD SLLNRISSGI SGDMLGSPEL CHGGDGLSSP ELGQGGPSAS  300
NMTTSPMAPP PPMVAADDHQ CNTNTPSGGG DGMSCEQTPA SSTFDGLNLD DIDMEGCWAM  360
TDILLAE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121174108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154659910.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g02250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g02250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4593420.0AY459342.1 Oryza sativa (japonica cultivar-group) clone CLC13210-1 R2R3-MYB gene region.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0015520.0AP001552.1 Oryza sativa Japonica Group geneomic DNA, chromosome 6, PAC clone:P0029D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641987.10.0PREDICTED: transcription factor MYB76
SwissprotQ8GWP01e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D3GC030.0A0A0D3GC03_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PSL20.0A0A0E0PSL2_ORYRU; Uncharacterized protein
STRINGBGIOSGA022174-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g02250.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP55293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-74myb domain protein 93