PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g01934.1
Common NameLOC4339876, Os06g0108900, OSNPB_060108900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 531aa    MW: 58365.3 Da    PI: 8.0238
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g01934.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-083143511954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+  ++  LA+++gL+ +qV++WF N R +
  LOC_Os06g01934.1 314 FEHflHPYPNDVDKHILARQTGLSRSQVSNWFINARVR 351
                       554459******************************88 PP

2BELL98.84.3e-32170238472
              BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +l+++ka++ls++eeVd+rY++y+eq+++v  sFeavag g+a++Yt+lA++a+SrhFrcL+da+++q+
  LOC_Os06g01934.1 170 DLERRKARILSMVEEVDRRYRRYREQMRAVEVSFEAVAGGGAAQVYTKLAMRAMSRHFRCLRDALVGQV 238
                       6899**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.5E-71101236IPR006563POX domain
PfamPF075261.2E-39107234IPR006563POX domain
PROSITE profilePS5007111.564292355IPR001356Homeobox domain
SMARTSM003896.5E-9295359IPR001356Homeobox domain
CDDcd000861.19E-11295356No hitNo description
SuperFamilySSF466895.99E-17296362IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-27298361IPR009057Homeodomain-like
PfamPF059202.5E-17312351IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MMAAHHHHHE HHHLLDMSSP PNASGAIISS FDHAAGLLSL HDVAAAADHH HHHLRGGGGG  60
LQLPSPWSQQ QVSLSLYNNA AGAAGSPPSS LVAHQQLAAA QPLMFQLRGS KYLGPVKALL  120
AEFCSLDVEA MDGAKQQRPP NPNPKIGKWD DVEGSGSWGN LSLSSMDLLD LERRKARILS  180
MVEEVDRRYR RYREQMRAVE VSFEAVAGGG AAQVYTKLAM RAMSRHFRCL RDALVGQVRA  240
LRNAMGESQR DAAGGVAAAA PGATKGDTPR LRVLDQCLRQ QRAFQQSGAV DSFPWRPQRG  300
LPERAVAVLR AWLFEHFLHP YPNDVDKHIL ARQTGLSRSQ VSNWFINARV RLWKPMIEDM  360
YKEETKPESS DGNNKLNPSA AGNKQQHRDD PKKNYTATTA EASLVQQSSY HLHLRSSGNR  420
NSSSLMIPAA ASTSIDHHHD SSHQLLGGHS YSSAAGLHHG HGGAVSLTLG LQQQQQPFAA  480
SMMHQHQQHQ HQHQQQQSFM VEAAEEEEDD VLPYRNLMES QLLHDFAGAS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-15301358158Homeobox protein Meis1
4xrs_A3e-15301358158Homeobox protein Meis1
3k2a_B3e-15301358562Homeobox protein Meis2
3k2a_A3e-15301358562Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.93320.0flower| leaf| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379881530.0
Expression AtlasQ0DF87-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g01934.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g01934
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2188950.0AB218895.1 Oryza sativa Japonica Group mRNA for OsBEL protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641004.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLQ0DF870.0Q0DF87_ORYSJ; Os06g0108900 protein
STRINGLOC_Os06g01934.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP63983547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.13e-87TALE family protein
Publications ? help Back to Top
  1. Nagasaki H,Matsuoka M,Sato Y
    Members of TALE and WUS subfamilies of homeodomain proteins with potentially important functions in development form dimers within each subfamily in rice.
    Genes Genet. Syst., 2005. 80(4): p. 261-7
    [PMID:16284419]