PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g01890.1
Common NameLOC107276241, Os06g0108500, OSNPB_060108500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24258.7 Da    PI: 10.0177
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g01890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.19.5e-281968251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rie++++rqvtfskRr+g+lKKA+ELSvLCdaeva+++fs++g+++ ++s
  LOC_Os06g01890.1 19 RIEDTTRRQVTFSKRRKGLLKKASELSVLCDAEVALLVFSPRGRFFHFAS 68
                      8*********************************************9986 PP

2K-box59.11.9e-2090177996
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       ++ ++  +++ +++ L  ei++ +   R+++Ge+Les+sl+eL+ Le q+eksl++iR +K++ l+++i++lq++ek l+een  L  
  LOC_Os06g01890.1  90 KKPRELTNMKSQSETLAMEIDTVEAYTRKMQGENLESCSLQELHGLEMQMEKSLSSIRLQKQKKLMDKISQLQQQEKILSEENALLLD 177
                       45567889***************************************************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.0951070IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-241232IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001266IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-311269IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-271392IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251966IPR002100Transcription factor, MADS-box
CDDcd002657.48E-322079No hitNo description
PRINTSPR004041.4E-243247IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-244768IPR002100Transcription factor, MADS-box
PfamPF014864.1E-2094177IPR002487Transcription factor, K-box
PROSITE profilePS5129712.23895187IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MAAAGGQQRR RGGRREMRRI EDTTRRQVTF SKRRKGLLKK ASELSVLCDA EVALLVFSPR  60
GRFFHFASAP SLEGTIDRYI SHTQEAPANK KPRELTNMKS QSETLAMEID TVEAYTRKMQ  120
GENLESCSLQ ELHGLEMQME KSLSSIRLQK QKKLMDKISQ LQQQEKILSE ENALLLDQGK  180
VQHAPIGAPA REMNQNQHVQ DIDVDTELVI GRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.748510.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160140060.0
Expression AtlasA0A0P0WS55-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g01890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g01890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2410550.0AK241055.1 Oryza sativa Japonica Group cDNA, clone: J065063N18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642542.11e-156PREDICTED: MADS-box transcription factor 50-like isoform X2
SwissprotA2Z9Q74e-56MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLA0A0P0WS551e-156A0A0P0WS55_ORYSJ; Os06g0108500 protein
TrEMBLI1PYU01e-156I1PYU0_ORYGL; Uncharacterized protein
STRINGLOC_Os06g01890.11e-156(Oryza sativa Japonica Group)
STRINGORGLA06G0005200.11e-156(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP174341010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-45AGAMOUS-like 20