PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g01670.1
Common NameLOC4339863, Os06g0105800, OSNPB_060105800, P0644B06.29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 295aa    MW: 32781 Da    PI: 7.2324
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g01670.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-124084147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r +WT  E++++++a +++  + Wk+I +++g  +t  q++s+ qky
  LOC_Os06g01670.1 40 RESWTDPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 84
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-163490IPR009057Homeodomain-like
PROSITE profilePS5129414.2343589IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-63890IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-183887IPR006447Myb domain, plants
SMARTSM007177.1E-103987IPR001005SANT/Myb domain
PfamPF002493.7E-104084IPR001005SANT/Myb domain
CDDcd001671.69E-74285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSSAPQQLLD SSSPGPGPGP EVEDDGGRRV RKPYTITKSR ESWTDPEHDK FLEALQLFDR  60
DWKKIEAYVG SKTVIQIRSH AQKYFLKVQK NGTGEHLPPP RPKRKAAHPY PHKASKRAPQ  120
VVLPQQASHL MEQGCLIPMD ISPVARNFNA NDVFSSWDSA LAQSFSPRHT HGAANNCSSS  180
VESQSGTCPT SEAIEQEIML PTLRAMPDFA QVYNFLGSIF DPETSGHLQR LREMDPIDVE  240
TVLLLMKNLS INLTNPNFEA HRKVLASHGY GMDQVKHENL GDLGSTHTLH LPFM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.239360.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379892630.0
Expression AtlasQ5VS69-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g01670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g01670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1116720.0AK111672.1 Oryza sativa Japonica Group cDNA clone:J013156D15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642931.10.0PREDICTED: protein REVEILLE 6
SwissprotQ8RWU36e-93RVE8_ARATH; Protein REVEILLE 8
TrEMBLQ5VS690.0Q5VS69_ORYSJ; Os06g0105800 protein
STRINGLOC_Os06g01670.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.22e-79MYB_related family protein