PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g51160.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 207aa    MW: 22192.9 Da    PI: 10.316
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g51160.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-13120164347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W+++E+ l++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qk+
  LOC_Os05g51160.2 120 PWSEQEHRLFLAGLEKLGKGDWRGISRSFVTTRTPTQVASHAQKF 164
                       8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.439113169IPR017930Myb domain
SuperFamilySSF466891.5E-16114170IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-17116167IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-10117160IPR009057Homeodomain-like
SMARTSM007173.8E-10117167IPR001005SANT/Myb domain
PfamPF002491.3E-10120163IPR001005SANT/Myb domain
CDDcd001673.50E-9120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MHAIMARRCS GDYSTAGQRA GEEGGGGGGA GLRLFGVQLH AAAASSPASY LHKSYSMDCL  60
RLQVSSPSSL QSSSSSPSPL TSSLLLSIDE GCERPAADGY LSDGPHGAAA TMRERKKGVP  120
WSEQEHRLFL AGLEKLGKGD WRGISRSFVT TRTPTQVASH AQKFFLRHNS AAKKTNNKRR  180
SSLFDMVRSH AYILHSYVHT SRAELS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.545360.0leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329907510.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g51160.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g51160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8588110.0HQ858811.1 Oryza sativa Japonica Group isolate UT1191 MYB-related transcription factor mRNA, partial cds.
GenBankAK0685950.0AK068595.1 Oryza sativa Japonica Group cDNA clone:J013154K05, full insert sequence.
GenBankAK0598130.0AK059813.1 Oryza sativa Japonica Group cDNA clone:006-205-B05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638259.11e-135PREDICTED: transcription factor MYB1R1
TrEMBLI1PYG41e-134I1PYG4_ORYGL; Uncharacterized protein
TrEMBLQ6I5E61e-134Q6I5E6_ORYSJ; MYB-related transcription factor
STRINGLOC_Os05g51160.11e-134(Oryza sativa Japonica Group)
STRINGORGLA05G0241200.11e-134(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-38MYB_related family protein