PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g51040.1
Common NameOsJ_19725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 195aa    MW: 21629 Da    PI: 6.9641
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g51040.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR34.73.6e-11644240
               TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                      e+ +C+C +s+C ++YC+Cf ++ +Cs++C+C++C N +
  LOC_Os05g51040.1  6 ERPKCSCVQSSCTQLYCRCFRSRYFCSDNCNCSGCYNIK 44
                      5679********************************965 PP

2TCR452.1e-14105143139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       k+ kgC+C+kskC k+YCeCf++ + C+ +CkC +C+N+
  LOC_Os05g51040.1 105 KHAKGCSCRKSKCSKLYCECFKNSVGCTAKCKCLECSNS 143
                       589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-5546IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.636145IPR005172CRC domain
PfamPF036381.1E-8942IPR005172CRC domain
SMARTSM011146.3E-12105146IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.3E-11108143IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MANNQERPKC SCVQSSCTQL YCRCFRSRYF CSDNCNCSGC YNIKYYEDAI EEISDMIQMK  60
NPNAFDPRII VSVQDATAAD PQSSTSAISD PKNTSDAMPG NEQRKHAKGC SCRKSKCSKL  120
YCECFKNSVG CTAKCKCLEC SNSFGVKNSE SSNKPDPDDK SATDGLTHEE TTTENITLPG  180
ETWNSDPNKR PRYF*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasB9FLV2
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g51040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g51040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126131e-130CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
GenBankAC0985981e-130AC098598.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1007_H05, complete sequence.
GenBankAP0149611e-130AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640257.11e-142PREDICTED: protein lin-54 homolog isoform X1
RefseqXP_015640258.11e-142PREDICTED: protein lin-54 homolog isoform X1
RefseqXP_015640259.11e-142PREDICTED: protein lin-54 homolog isoform X1
RefseqXP_015640260.11e-142PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2
TrEMBLA0A0E0PRX51e-142A0A0E0PRX5_ORYRU; Uncharacterized protein
TrEMBLB9FLV21e-142B9FLV2_ORYSJ; Uncharacterized protein
TrEMBLQ6L5B71e-142Q6L5B7_ORYSJ; Putative uncharacterized protein OJ1007_H05.13
STRINGLOC_Os05g51040.11e-142(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122672336
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.18e-22Tesmin/TSO1-like CXC domain-containing protein