PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g50610.2
Common NameLOC4339739, OJ1651_G11.15, Os05g0583000, OsJ_29859, OSJNBb0035N21.12, OSNPB_050583000, WRKY8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 338aa    MW: 36075.1 Da    PI: 6.7038
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g50610.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.11.9e-33188245259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s +prsYYrCt ++C vkk+vers++dp++v++tYeg+H+h+
  LOC_Os05g50610.2 188 EDGYRWRKYGQKAVKNSSYPRSYYRCTAPRCGVKKRVERSEQDPSMVITTYEGQHTHP 245
                       8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-35172247IPR003657WRKY domain
SuperFamilySSF1182903.14E-29179247IPR003657WRKY domain
PROSITE profilePS5081130.572182247IPR003657WRKY domain
SMARTSM007742.7E-39187246IPR003657WRKY domain
PfamPF031065.2E-27188245IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSGPGGGGHG LYEDHPAAAG FLPFDHDDDV VASFFFGRSA ASGGGAGAGA GAGDDDGVGL  60
ITPYSSITDY LQGFLQDPVY ASSPLGGDAA VKHETVVDHP SQAGGVAAAP ATPNSSVLSS  120
SSEAAGGDDL RRCKKGRRPE DEEEEEIDDE GSAVQSCKTN KMKNKKGAKK EREPRVAFMT  180
KSEVDHLEDG YRWRKYGQKA VKNSSYPRSY YRCTAPRCGV KKRVERSEQD PSMVITTYEG  240
QHTHPSPVSY HMHRQQGLMH VSARGVMPGA AGAYQFGAPP PPLLGFDEAL AARVRMTMNQ  300
QQQQQQLGFV PSIHAAAARP TMPPLHLYTA QQDLFLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-27178247877Probable WRKY transcription factor 4
2lex_A2e-27178247877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.299870.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335192010.0
Expression AtlasQ75HY3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g50610.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g50610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8706000.0AY870600.1 Oryza sativa (japonica cultivar-group) WRKY8 mRNA, complete cds.
GenBankAK1095680.0AK109568.1 Oryza sativa Japonica Group cDNA clone:002-130-E04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637709.10.0PREDICTED: probable WRKY transcription factor 23 isoform X2
TrEMBLA0A0E0PRS60.0A0A0E0PRS6_ORYRU; Uncharacterized protein
TrEMBLQ75HY30.0Q75HY3_ORYSJ; Os05g0583000 protein
STRINGBGIOSGA017481-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.19e-43WRKY DNA-binding protein 28
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]