PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g50610.1
Common NameLOC4339739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 504aa    MW: 54999.6 Da    PI: 9.2857
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g50610.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.86.1e-30188244259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s +p sYYrCt ++C vkk+vers++dp++v++tYeg+H+h+
  LOC_Os05g50610.1 188 EDGYRWRKYGQKAVKNSSYP-SYYRCTAPRCGVKKRVERSEQDPSMVITTYEGQHTHP 244
                       8*******************.9***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-32172246IPR003657WRKY domain
SuperFamilySSF1182901.7E-25179246IPR003657WRKY domain
PROSITE profilePS5081127.129182246IPR003657WRKY domain
SMARTSM007749.2E-35187245IPR003657WRKY domain
PfamPF031061.6E-23188244IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MSGPGGGGHG LYEDHPAAAG FLPFDHDDDV VASFFFGRSA ASGGGAGAGA GAGDDDGVGL  60
ITPYSSITDY LQGFLQDPVY ASSPLGGDAA VKHETVVDHP SQAGGVAAAP ATPNSSVLSS  120
SSEAAGGDDL RRCKKGRRPE DEEEEEIDDE GSAVQSCKTN KMKNKKGAKK EREPRVAFMT  180
KSEVDHLEDG YRWRKYGQKA VKNSSYPSYY RCTAPRCGVK KRVERSEQDP SMVITTYEGQ  240
HTHPSPVSYH MHRQQGLMHV SARGVMPGAA GAYQFGAPPP PLLGFDEALA ARSQDTVLVS  300
QEDRLSQQQR SLYYRVDVQS CWAADRSRAH NCITKGKRKP GLGPNNTGAT WELGRNPKTH  360
RSRLAPGRTP HQQDPLRLLQ RLGGDYLYRA RRGVHFTHTT LLTRITQPVG ISHVGRPPSF  420
HDKAFPKPIQ VYHMPTRGVP DQQQESVLKC ESGKTVHPAQ DVQRWLALLE IWSLILEILA  480
LRVFGLRNYT RNGTTQQTAK MKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-24178246877Probable WRKY transcription factor 4
2lex_A7e-24178246877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.299870.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335192010.0
Expression AtlasQ7XAA1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g50610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g50610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418570.0AY341857.1 Oryza sativa (japonica cultivar-group) WRKY17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637708.10.0PREDICTED: uncharacterized protein LOC4339739 isoform X1
TrEMBLQ7XAA10.0Q7XAA1_ORYSJ; WRKY17
STRINGLOC_Os05g50610.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.12e-38WRKY DNA-binding protein 28