PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g50310.1
Common Name10A19I.6, LOC4339713, Os05g0579300, OsJ_19667, OSJNBa0017N18.8, ZHD6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 256aa    MW: 27959.1 Da    PI: 8.8416
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g50310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer971.5e-304295358
       ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                      +vrY+eCl+NhAa++Ggh+vDGC+Efmp +g+   a+alkCaACgCHR+FHR++  
  LOC_Os05g50310.1 42 EVRYHECLRNHAAAMGGHVVDGCREFMPMPGDA--ADALKCAACGCHRSFHRKDDG 95
                      79***************************8876..9*****************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.6E-264393IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-244393IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-244493IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.5194593IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.14E-20160230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-31161231IPR009057Homeodomain-like
TIGRFAMsTIGR015651.2E-26172228IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEFRGHDEPV DEMGVAYGRT PPSSSSSPAA SASAGNGAGA AEVRYHECLR NHAAAMGGHV  60
VDGCREFMPM PGDAADALKC AACGCHRSFH RKDDGQQQQQ LRLLIPSPPT PRVPLLMPPP  120
QPQPHPHPQH PYLHPPFPYH HTPSGSGGTT TESSSEERGP PSSSAAAAQG RRKRFRTKFT  180
PEQKEQMLAF AERVGWRMQK QDEALVEQFC AQVGVRRQVF KVWMHNNKSS IGSSSGGGSR  240
RQPQEQQSQQ QQQQQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-281732361880ZF-HD homeobox family protein
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329965590.0
Expression AtlasQ688U3-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g50310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g50310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1209880.0AC120988.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0017N18, complete sequence.
GenBankAC0078580.0AC007858.1 Oryza sativa (japonica cultivar-group) chromosome 5 clone BAC 10A19I, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankAK1113500.0AK111350.1 Oryza sativa Japonica Group cDNA clone:002-181-G06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639557.10.0PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ688U30.0ZHD6_ORYSJ; Zinc-finger homeodomain protein 6
TrEMBLA0A0E0DUU51e-132A0A0E0DUU5_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g50310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.17e-34zinc finger homeodomain 1
Publications ? help Back to Top
  1. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]