PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g49930.1
Common NameLOC4339687, OJ1268_B08.12, Os05g0574900, OSNPB_050574900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 501aa    MW: 52995 Da    PI: 6.2953
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g49930.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.22.4e-109784542374
              GRAS   2 velLlecAeavssgdlelaqalLarlsel..aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                       v+l+++cA a+++gd ++a   L+  +e+    p+  + + R+ ++f+ ALa+rl+   ++   + pp + +     e+   ++ f+e+ P+l
  LOC_Os05g49930.1  78 VNLMVTCAGAIQAGDYAAAAGSLSDAREIfaKMPTTrTGIGRVLTHFADALAERLFPAFPQ---SAPPPPPP---RGEQRELFRGFYEAGPYL 164
                       6899************************98644444499*****************94443...33444444...4555567899******** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       kf+hl+aNqaIlea+eg++ vH+iDf ++ G+QWp+L+qaLa Rp+gpp lRiTg+g++++g+++el+ +g rLa+fA+++ vpf f+ ++a+
  LOC_Os05g49930.1 165 KFAHLAANQAILEAFEGCNSVHVIDFALTDGIQWPSLIQALAVRPGGPPFLRITGIGPHAAGNRDELRDVGLRLAEFARSCSVPFAFRGIAAD 257
                       **********************************************************9999******************************* PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                       +l+ l++++++v pgEa+a+n+vlqlhrll ++ + +      ++d vL+ v s++P+v++vveqeadhn++s+lerf+++l yy+++fdsle
  LOC_Os05g49930.1 258 QLDGLRPWMFQVAPGEAVAINSVLQLHRLLVDQDAAAAasfpaPIDGVLDWVASMNPRVFTVVEQEADHNKSSLLERFTNSLFYYASMFDSLE 350
                       *****************************9544333333455599***********************************************9 PP

              GRAS 273 aklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                       a   +     + + + +++l+ ei ++v+ eg++r+erhe++ +W erl++ G++++pl+ +   qa + lr++++ g+ v+e+ g l+l+W+
  LOC_Os05g49930.1 351 AISRHGGgdGAGNPLAEAYLQGEIADIVSREGSSRVERHEQMPRWVERLRRGGMTQLPLGATGLWQAAMQLREFSGAGFGVQENGGFLTLTWH 443
                       87433334599999******************************************************************************* PP

              GRAS 364 drpLvsvSaWr 374
                       +++L+s+SaWr
  LOC_Os05g49930.1 444 SQRLYSASAWR 454
                       **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.10151434IPR005202Transcription factor GRAS
PfamPF035148.4E-10778454IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MAQFGGFGGW SAMDVAAAAA AALGNVSGAV YHADPAAAVY ASLVPGMAVV PGRAPPSAVQ  60
IEAARRWKEL EKMALRSVNL MVTCAGAIQA GDYAAAAGSL SDAREIFAKM PTTRTGIGRV  120
LTHFADALAE RLFPAFPQSA PPPPPPRGEQ RELFRGFYEA GPYLKFAHLA ANQAILEAFE  180
GCNSVHVIDF ALTDGIQWPS LIQALAVRPG GPPFLRITGI GPHAAGNRDE LRDVGLRLAE  240
FARSCSVPFA FRGIAADQLD GLRPWMFQVA PGEAVAINSV LQLHRLLVDQ DAAAAASFPA  300
PIDGVLDWVA SMNPRVFTVV EQEADHNKSS LLERFTNSLF YYASMFDSLE AISRHGGGDG  360
AGNPLAEAYL QGEIADIVSR EGSSRVERHE QMPRWVERLR RGGMTQLPLG ATGLWQAAMQ  420
LREFSGAGFG VQENGGFLTL TWHSQRLYSA SAWRATAGKK MTMMASGAAD AMEESQNSNT  480
NGGGGGSSGG GHGALNQIMQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4411945442375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.478980.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329924650.0
Expression AtlasQ6F368-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g49930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g49930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0988320.0AC098832.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1268_B08, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankAK1072560.0AK107256.1 Oryza sativa Japonica Group cDNA clone:002-125-G08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638486.10.0PREDICTED: DELLA protein SLR1-like
TrEMBLA0A0E0PRK20.0A0A0E0PRK2_ORYRU; Uncharacterized protein
TrEMBLQ6F3680.0Q6F368_ORYSJ; Os05g0574900 protein
STRINGLOC_Os05g49930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.12e-88GRAS family protein