PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g49780.1
Common NameOsJ_19626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 142aa    MW: 15300.2 Da    PI: 4.732
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g49780.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB167.71.4e-5221114295
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       +eqdrflPian++rim++++P+n+ki+kd+ke+vqecvsefisf+tseasdkc +ekrktingddl+w+++tlGfedyveplk+yl+ yre +
  LOC_Os05g49780.1  21 KEQDRFLPIANIGRIMRRAVPENGKIAKDSKESVQECVSEFISFITSEASDKCLKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLRLYREGD 113
                       89****************************************************************************************966 PP

             NF-YB  95 g 95 
                       +
  LOC_Os05g49780.1 114 T 114
                       5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-4720120IPR009072Histone-fold
SuperFamilySSF471134.66E-3623118IPR009072Histone-fold
PfamPF008087.7E-262690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.5E-195472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.5E-197391No hitNo description
PRINTSPR006154.5E-1992110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MSEGFDGTEN GGGGGGGGVG KEQDRFLPIA NIGRIMRRAV PENGKIAKDS KESVQECVSE  60
FISFITSEAS DKCLKEKRKT INGDDLIWSM GTLGFEDYVE PLKLYLRLYR EGDTKGSRAS  120
ELPVKKDVVL NGDPGSSFEG M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4621111393NF-YB
4awl_B3e-4621111494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4621111494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.280380.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166318180.0
Expression AtlasB9FLQ6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g49780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g49780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0954400.0AB095440.1 Oryza sativa Japonica Group OsHAP3C mRNA for HAP3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638071.12e-88PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotQ65XK13e-90NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4
TrEMBLB9FLQ69e-96B9FLQ6_ORYSJ; Uncharacterized protein
STRINGLOC_Os05g49780.16e-88(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.72e-56nuclear factor Y, subunit B1