PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g49310.1
Common NameLOC4339647, Os05g0568200, OsJ_19586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 250aa    MW: 26862.7 Da    PI: 6.3597
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g49310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-162269148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd+ lv++++  G g W+t ar  g++Rt+k+c++rw++yl
  LOC_Os05g49310.1 22 KGPWTMEEDLSLVNYIAANGEGAWNTLARAAGLNRTGKSCRLRWLNYL 69
                      79********************************************97 PP

2Myb_DNA-binding54.72.4e-1775118146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T+eE+ l+v++ +++G++ W++Iar+++ gRt++++k++w++
  LOC_Os05g49310.1  75 RGNITPEEHTLIVELQARWGNR-WSKIARYLP-GRTDNEVKNFWRT 118
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9371769IPR017930Myb domain
SuperFamilySSF466891.61E-2920116IPR009057Homeodomain-like
SMARTSM007173.5E-112171IPR001005SANT/Myb domain
PfamPF002494.6E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-212376IPR009057Homeodomain-like
CDDcd001673.03E-82469No hitNo description
PROSITE profilePS5129424.28170124IPR017930Myb domain
SMARTSM007172.0E-1474122IPR001005SANT/Myb domain
PfamPF002497.7E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2177123IPR009057Homeodomain-like
CDDcd001676.28E-1279118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MQYTVEGSGG GGVQTVEAAV RKGPWTMEED LSLVNYIAAN GEGAWNTLAR AAGLNRTGKS  60
CRLRWLNYLR PDVRRGNITP EEHTLIVELQ ARWGNRWSKI ARYLPGRTDN EVKNFWRTKI  120
QKKHRKSTDG IYATTTSESI MPAATVHQNT VAEDQGSSSV SGRTTTATVA VTQEYATEAP  180
PPSGMSSGSY LDQLQPGYAS SIHGGQDGGA AAAAAGDVVV SDEFLAASSD NFWALEDLWP  240
TVQSLHGNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24221237107B-MYB
1h8a_C2e-241412319127MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154655120.0
Expression AtlasQ0DFV3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g49310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g49310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1209900.0AC120990.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0040E06, complete sequence.
GenBankAC1209860.0AC120986.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1781_H11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639020.10.0PREDICTED: transcription factor MYB21
SwissprotQ9LK955e-72MYB21_ARATH; Transcription factor MYB21
TrEMBLQ0DFV30.0Q0DFV3_ORYSJ; Os05g0568200 protein
STRINGLOC_Os05g49310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-70myb domain protein 21