PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g49280.1
Common NameOs05g0567900, OSNPB_050567900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 251aa    MW: 25606.8 Da    PI: 8.1815
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g49280.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA611.5e-19130164135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C+nC t +TplWR+gp+g+k+LCnaCG++y+k+++
  LOC_Os05g49280.1 130 CANCDTMSTPLWRNGPRGPKSLCNACGIRYKKEER 164
                       ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.52E-14123165No hitNo description
PROSITE profilePS5011413.811124160IPR000679Zinc finger, GATA-type
SMARTSM004018.6E-19124176IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.1E-17128164IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.10E-12129161No hitNo description
PfamPF003205.7E-17130164IPR000679Zinc finger, GATA-type
PROSITE patternPS003440130155IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009909Biological Processregulation of flower development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MLQELAPCTC GMLYGSCGGG CGGAAAAASA FSLLFPMAGG QYYYRQCGGV AEEDSRSPYG  60
GGGAAVDCTL SLGTPSTRRA EAGAYGGGLQ PWDVPSSARP GGGGGGKQDG AGVAPCNKEA  120
PAAGRLPRRC ANCDTMSTPL WRNGPRGPKS LCNACGIRYK KEERRAAAAV APTPPPSLDT  180
GAGYAYCYSR QPPPPPAPQW GCYGQAAAKS ASYAMFDAAD DGPCLSWRLN MMPSSPAFAV  240
GERPGLFQYY *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1019603e-37stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0WQZ5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g49280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g49280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1209860.0AC120986.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1781_H11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638692.11e-150PREDICTED: GATA transcription factor 19-like
TrEMBLA0A0E0PRD61e-177A0A0E0PRD6_ORYRU; Uncharacterized protein
TrEMBLA0A0P0WQZ51e-177A0A0P0WQZ5_ORYSJ; Os05g0567900 protein
TrEMBLB8AWS71e-177B8AWS7_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA017544-PA1e-176(Oryza sativa Indica Group)
STRINGLOC_Os05g49280.11e-176(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP166537102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18380.18e-27GATA transcription factor 20