PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g49100.1
Common NameLOC9268095, OJ1781_H11.1, Os05g0565900, OsJ_19568, OSNPB_050565900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 420aa    MW: 43953.8 Da    PI: 6.6777
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g49100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.3e-33201258259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s+fprsYYrCt+++Cpvkk+vers +d  vv++tYeg+H+h+
  LOC_Os05g49100.1 201 EDGYRWRKYGQKAVKNSPFPRSYYRCTTQKCPVKKRVERSYQDAAVVITTYEGKHTHP 258
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.1E-35185260IPR003657WRKY domain
SuperFamilySSF1182903.53E-29192260IPR003657WRKY domain
PROSITE profilePS5081131.95195260IPR003657WRKY domain
SMARTSM007743.2E-39200259IPR003657WRKY domain
PfamPF031063.1E-26201258IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MSGGGGGGEG FPFHDELASL FAERPPNGAM PGMLQQQQPW SFIDYHHHLM QESAPTTPPL  60
DYEAFAGEFD DDVAPLEEVK RELVVDGVGL FPGGGASAAA AAAAVAGPMT PNSMSVSSTS  120
SEACGVGGGA GGDEESAGKC KKEEEGDGGD DDGKEGSSTT KGDGDGEDKN KKGGKGKGKG  180
EKRPRQPRFA FMTKSEVDHL EDGYRWRKYG QKAVKNSPFP RSYYRCTTQK CPVKKRVERS  240
YQDAAVVITT YEGKHTHPIP ATLRGTAHLL GAAAAAHHHG GLQYHHPGHF AAAVGHRLPP  300
QPHDALGGGL LAPPHAQHLH AMQHQMQLAA AAAASGGSLH AAAMQQMPQP DHAGLVAIIA  360
STTGASTTPP PPPATGSAAA ATTPLRMQHF MAQDYGLLQD MFIPSPFLHN DDANNNNHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26191261878Probable WRKY transcription factor 4
2lex_A3e-26191261878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ688X5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g49100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g49100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1209860.0AC120986.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1781_H11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637917.10.0PREDICTED: probable WRKY transcription factor 23
TrEMBLA0A0E0PRB20.0A0A0E0PRB2_ORYRU; Uncharacterized protein
TrEMBLQ688X50.0Q688X5_ORYSJ; Os05g0565900 protein
STRINGLOC_Os05g49100.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-43WRKY DNA-binding protein 71