PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g48990.1
Common NameOs05g0564500, OsJ_018772, OSJNBb0053D02.14, WOX12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 516aa    MW: 54610.1 Da    PI: 6.9203
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g48990.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.43.7e-1670129256
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                       ++R+++ +eq+++Le  F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k
  LOC_Os05g48990.1  70 KPRWNPRPEQIRILEGIFNSgMVNPPRDEIRRIRLQLqeygQVGDANVFYWFQNRKSRTK 129
                       89*****************99*************************************99 PP

2Wus_type_Homeobox107.76.8e-3569131264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe +++sG+++P+++ei+ri+ +L+eyG+++d+NVfyWFQNrk+R ++k
   LOC_Os05g48990.1  69 PKPRWNPRPEQIRILEGIFNSGMVNPPRDEIRRIRLQLQEYGQVGDANVFYWFQNRKSRTKNK 131
                        689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-1164136IPR009057Homeodomain-like
PROSITE profilePS5007110.07466131IPR001356Homeobox domain
SMARTSM003895.8E-668135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-669134IPR009057Homeodomain-like
CDDcd000861.05E-669131No hitNo description
PfamPF000468.4E-1470129IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MASPNRHWPS MFRSNLACNI QQQQQPDMNG NGSSSSSFLL SPPTAATTGN GKPSLLSSGC  60
EEGTRNPEPK PRWNPRPEQI RILEGIFNSG MVNPPRDEIR RIRLQLQEYG QVGDANVFYW  120
FQNRKSRTKN KLRAAGHHHH HGRAAALPRA SAPPSTNIVL PSAAAAAPLT PPRRHLLAAT  180
SSSSSSSDRS SGSSKSVKPA AAALLTSAAI DLFSPAPAPT TQLPACQLYY HSHPTPLARD  240
DQLITSPESS SLLLQWPASQ YMPATELGGV LGSSSHTQTP AAITTHPSTI SPSVLLGLCN  300
EALGQHQQET MDDMMITCSN PSKVFDHHSM DDMSCTDAVS AVNRDDEKAR LGLLHYGIGV  360
TAAANPAPHH HHHHHHLASP VHDAVSAADA STAAMILPFT TTAAATPSNV VATSSALADQ  420
LQGLLDAGLL QGGAAPPPPS ATVVAVSRDD ETMCTKTTSY SFPATMHLNV KMFGEAAVLV  480
RYSGEPVLVD DSGVTVEPLQ QGATYYVLVS EEAVH*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA3B6V0
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g48990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g48990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1241430.0AC124143.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0053D02, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638690.10.0PREDICTED: WUSCHEL-related homeobox 12
SwissprotA3B6V00.0WOX12_ORYSJ; WUSCHEL-related homeobox 12
TrEMBLA0A0E0PRA20.0A0A0E0PRA2_ORYRU; Uncharacterized protein
TrEMBLB8AWR60.0B8AWR6_ORYSI; Putative uncharacterized protein
TrEMBLB9FLM60.0B9FLM6_ORYSJ; Uncharacterized protein
STRINGBGIOSGA020366-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g48990.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP61031220
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-46homeobox-3
Publications ? help Back to Top
  1. Nardmann J,Werr W
    The shoot stem cell niche in angiosperms: expression patterns of WUS orthologues in rice and maize imply major modifications in the course of mono- and dicot evolution.
    Mol. Biol. Evol., 2006. 23(12): p. 2492-504
    [PMID:16987950]