PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g48870.1
Common NameARF15, LOC9268260, Os05g0563400, OsJ_018762, OSJNBb0053D02.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 713aa    MW: 78079.8 Da    PI: 7.0914
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g48870.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.75.3e-24142243199
                       EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                       f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d+++ +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + 
  LOC_Os05g48870.1 142 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyS-QQRPSQELVAKDLHSTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RG 231
                       99****************************963.3445679************************************************..34 PP

                       SEE..EEEEE-S CS
                B3  88 sefelvvkvfrk 99 
                       +++el+++v+r+
  LOC_Os05g48870.1 232 DDGELRLGVRRA 243
                       89999***9996 PP

2Auxin_resp111.39.3e-37268348182
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                       +aha++t+svF+++YnPr s+seF+v+++k++k+l++++svG Rfkm++e+ed+ err++G+++g  d+dp  W++SkW++L
  LOC_Os05g48870.1 268 VAHAVATESVFNIYYNPRLSQSEFIVPYWKFMKSLSQPFSVGLRFKMRYESEDATERRYTGIITGSGDTDP-MWHGSKWKCL 348
                       79*********************************************************************.9********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.0E-40135245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.62E-43136258IPR015300DNA-binding pseudobarrel domain
CDDcd100177.51E-22140242No hitNo description
PROSITE profilePS5086312.971142244IPR003340B3 DNA binding domain
SMARTSM010192.1E-22142244IPR003340B3 DNA binding domain
PfamPF023629.1E-22142243IPR003340B3 DNA binding domain
PfamPF065074.0E-31268348IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MTGIDLNTVE EDEEEAAEEV AANGSSPAPA RAGAVCLELW HACAGPVAPL PRKGGVVVYL  60
PQGHLEHLGD APAAAAAAAA VPPHVFCRVV DVTLLADAAT DEVYAQLSLV PEKEEVARRA  120
DDGEGEDGDG MKQRFARMPH MFCKTLTASD TSTHGGFSVP RRAAEDCFPP LDYSQQRPSQ  180
ELVAKDLHST EWRFRHIYRG QPRRHLLTTG WSAFVNKKKL VSGDAVLFLR GDDGELRLGV  240
RRAAQLKNGS AFPALYNQCS NLGTLANVAH AVATESVFNI YYNPRLSQSE FIVPYWKFMK  300
SLSQPFSVGL RFKMRYESED ATERRYTGII TGSGDTDPMW HGSKWKCLLV RWDDDAEFRR  360
PNRVSPWEIE LTSSVSGSHL STPHSKRLKP CLPHVNPEYM VPRGGGCPDF AESAQFHKVL  420
QGQELLGFKS HGGTAAATSQ PCEARHLQYI DERSCSSDAS NSILGVPRLG DRAPLGNPGF  480
SYHCSGFGES HRLQKVLQGQ ELFRPYRGTL VDASMGSNGF HQQDSPRAPG VVNKWQAQLH  540
GRAAFHGPPA LALPSQSSSP PSVLMFQQAN SKMPRLEFGH GQLDKHENDR RVRFGPSEGI  600
ERREQRIPLQ PYPTSGEVID GQVTVEKSHS PGRHGKDGPD NKAVGTNSCK IFGISLTEKV  660
PAREELDDGD ANYSLQSLKQ VPKSLGNSCA TVHEQRPVVG RVIDISTMDM MI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-117213783361Auxin response factor 1
4ldw_A1e-117213783361Auxin response factor 1
4ldw_B1e-117213783361Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.110360.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329850020.0
Expression AtlasQ8S985-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g48870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g48870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712900.0AB071290.1 Oryza sativa OsETTIN1 mRNA for Arabidopsis ETTIN-like protein 1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640263.10.0PREDICTED: auxin response factor 15
SwissprotQ8S9850.0ARFO_ORYSJ; Auxin response factor 15
TrEMBLA0A0E0PR880.0A0A0E0PR88_ORYRU; Auxin response factor
STRINGLOC_Os05g48870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP66851018
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-160ARF family protein
Publications ? help Back to Top
  1. Sato Y, et al.
    Auxin response factor family in rice.
    Genes Genet. Syst., 2001. 76(6): p. 373-80
    [PMID:11922106]
  2. Wang D, et al.
    Genome-wide analysis of the auxin response factors (ARF) gene family in rice (Oryza sativa).
    Gene, 2007. 394(1-2): p. 13-24
    [PMID:17408882]