PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g48820.1
Common NameLOC4339610, OsJ_19544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-other
Protein Properties Length: 1856aa    MW: 206401 Da    PI: 5.1252
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g48820.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.64.9e-1959113357
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       kR   t++qle+Le+ + +++yp++++r+eL+ klgLt+rq ++WF+ rR k++k
  LOC_Os05g48820.1  59 KRVMKTPYQLEVLERTYTEDPYPNETMRAELSVKLGLTDRQLQMWFCHRRLKDRK 113
                       8999*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.57E-1741113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-1751113IPR009057Homeodomain-like
PROSITE profilePS5007116.64954114IPR001356Homeobox domain
SMARTSM003892.6E-1756118IPR001356Homeobox domain
CDDcd000861.92E-1457114No hitNo description
PfamPF000469.7E-1759113IPR001356Homeobox domain
PROSITE profilePS5082715.766618677IPR018501DDT domain
SMARTSM005712.2E-18618677IPR018501DDT domain
PfamPF027917.1E-16620674IPR018501DDT domain
PfamPF050662.9E-15796863IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.8E-1010181060IPR028942WHIM1 domain
PfamPF156138.0E-1311971268IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1856 aa     Download sequence    Send to blast
MDSSGDGGDE GAGAAPAGVE EESPAPASAP APAPASASAP VPAAVGGGAG ASGSSGKVKR  60
VMKTPYQLEV LERTYTEDPY PNETMRAELS VKLGLTDRQL QMWFCHRRLK DRKPPPKRQQ  120
LEEEVPVPVM APPPVLPPPL PHSELTMGTG GMYGEPLLSP SSRRGTGRPS AVPRISASEV  180
ARRYYEPPQV MLPPLAPMQL TRAEHRVIDS VERLIGEPLR EDGPVLGVEF DPLPPGAFGA  240
PIVPEQQRQP FRSYEAKMFS GHDTKHIKAS AFLPSIDPFV PSTVSGKRKS MTGSSSHLGS  300
RAVREYQFIP EQSSDIYERT TQSRYYDVLT EASDSRMSTG SRFLHGVEKA PGYTFHGQIS  360
GSSHLSLHGR PPVFSSGSTD YEMDPSNINS SSVPNESQYG IPQVAGFENS VAPSDRMVYH  420
DDDAFRMERK RKHSEEVKIA KEVEAHEKRI RKELEKQDML NRKREEQVRR EMERNDRERR  480
KEEERLLREK QKEEERFQRE QRREHKRMEK YLLKQSLRAE KIRQKEELRK EKEAARQKAA  540
NERATARRIA REYMELMEDE RLELMELVSR SKGLPSMLSL DSDTLQQLDS FRGMLRQFPS  600
EIVRLKVPFS IKPWTSSEDN IGNLLMVWKF FITFADVLGI PSFTLDEFVQ SLHDYDSRLL  660
GELHVALLKS IIKDIEDVAR TPSVASGMTA NPGGGHPQIV EGAYDWGFNI LAWQRHLNLL  720
TWPEILRQFG LSAGLGPQLR KRNAENVNNH DDNEGRNGED VISILRSGSA AVNAAAKMKE  780
RGYGNRRRSR HRLTPGTVKF AAFHVLSLEG SQGLTILEVA EKIQKSGLRD LTTSKTPEAS  840
ISAALSRDSK LFERTAPSTY CVKTPYRKDP ADSEAVLAAA REKIRVFQNT ISECEEVEKD  900
VDDAERDEDS ECDDADDDPD GDEVNIEEKD VKTSLVKAQD GGMPTAVGDI KKETNSIVNS  960
LTTPLIHTKS SESSSLRTLD KSVQVRTTSD LPAEISSDNH EGASDSAQDA EIDESNQGES  1020
WVQGLAEGDY CDLSVEERLN ALVALIGVAT EGNSIRAVLE ERLEAASALK KQMWAEAQLD  1080
KRRSREEFSS KMQYDSGMGL KTDVDQQNTL AESNLTPVHN LVKDSNGNGS LVNNELPVDQ  1140
QSQPNACSVV HERNGVRQEF SANPENLSGQ QYVTSEKTRS QLKSYIGHKA EQLHVYRSLP  1200
LGQDRRRNRY WQFSTSASPD DPGSGRIFFE SRDGYWRLID SIETFDALVS SLDTRGIRES  1260
HLHSMLQSIE PTFKEAIGRK RCASIEPSAG RVLKNGTSEI ISPNHSNEFG SPCSTLSGVA  1320
TDSAMAYSDS FRIELGRNDV EKTAISERAD LFIKWMWKEC NNHQPTCAMK HGKKRCSELI  1380
QCCDFCYQIY LAEETHCASC HKTFKSIHNI SEHSSQCEEK RRTDPNWKMQ ISDYSVPVGL  1440
RLLKLLLATV EASVPAEALE PFWTDVYRKS WGVKLYSTSS TKEVFEMLTI LEGAIRRDFL  1500
SSDFETTTEL LNLSTQDSAS RNTVPRSGSA DVLPWVPDTV AAVVLRLLDL DSAISYTLRQ  1560
KVGSNKERGA GEFMKLPPRY TPAKTKQETE PMGTGFDRQE TWLTPSNGRG GRGGRGRGSR  1620
GGSRGGRSRS RGGKVPRGIS SSPKIEFRGY SASAVSSEKA PRKYARRGRN RGRGRGLRTV  1680
RPRQPSDIGA RSIPKPNLLG SFSMLRNAKH TTAMESPQSS GAEEWGLERR PSYVKDDEDN  1740
SASQSEESSE ENSEPMNEEY DELLPDYSRD NSGSSPLQMM DDGSDDNEED AEGDEDGEED  1800
GEDYDAEQHV DEDNDDAEMG EDDVEDNDDG DGGGGGAENG DEDEDGTSYS SEYSE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.60860.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379908600.0
Expression AtlasB9FI45-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g48820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g48820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1212370.0AK121237.1 Oryza sativa Japonica Group cDNA clone:J023095K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639400.10.0PREDICTED: homeobox-DDT domain protein RLT2 isoform X1
TrEMBLA0A0E0PR790.0A0A0E0PR79_ORYRU; Uncharacterized protein
TrEMBLB9FI450.0B9FI45_ORYSJ; Uncharacterized protein
STRINGLOC_Os05g48820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15771634
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator