PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g46610.1
Common NameLOC4339490, Os05g0543600, OSNPB_050543600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 313aa    MW: 33606.2 Da    PI: 5.0532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g46610.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88e-161663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  LOC_Os05g46610.1 16 KGLWSPEEDDKLYNHIIRHGVGCWSSVPKLAGLQRCGKSCRLRWINYL 63
                      678*******************************************97 PP

2Myb_DNA-binding52.61.1e-1669113147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++++E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  LOC_Os05g46610.1  69 RGSFSQQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 113
                       899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-231166IPR009057Homeodomain-like
PROSITE profilePS5129415.9411163IPR017930Myb domain
SuperFamilySSF466891.88E-2814110IPR009057Homeodomain-like
SMARTSM007175.5E-121565IPR001005SANT/Myb domain
PfamPF002491.7E-141663IPR001005SANT/Myb domain
CDDcd001675.74E-111963No hitNo description
PROSITE profilePS5129426.03864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2667118IPR009057Homeodomain-like
SMARTSM007172.5E-1668116IPR001005SANT/Myb domain
PfamPF002496.5E-1569113IPR001005SANT/Myb domain
CDDcd001671.52E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001059developmental stageJ bicellular pollen stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRLSSCGGV QAKLRKGLWS PEEDDKLYNH IIRHGVGCWS SVPKLAGLQR CGKSCRLRWI  60
NYLRPDLKRG SFSQQEEDLI VALHEILGNR WSQIASHLPG RTDNEIKNFW NSCLKKKLRQ  120
RGLDPATHKP IAAAAAAATS SESAVTQVDE DHKPHGAAAA AAAADGLAAN AKQSVFDPFP  180
VTDFGAGFDL GAANMAAALY GSHPDDGAGF VADYSSVLDV SENLGYGESS SNSSNWTCAE  240
VSNVLDSEVL NWAASAGADA AAKAEPFADM EQQHSGYGGE YQVEDDATLE HKFSLPCHEQ  300
SLAQFDFNLE YF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141185108B-MYB
1h8a_C1e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.486080.0callus| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasJ9PDC7
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g46610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g46610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0467880.0GU046788.1 Oryza sativa Japonica Group cultivar Dongjin-byeo myb-related protein mRNA, complete cds.
GenBankAK2874690.0AK287469.1 Oryza sativa Japonica Group cDNA, clone: J043021L20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638185.10.0PREDICTED: myb-related protein Hv33
SwissprotP200271e-122MYB3_HORVU; Myb-related protein Hv33
TrEMBLJ9PDC70.0J9PDC7_ORYSJ; Myb-related protein
STRINGLOC_Os05g46610.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.14e-75myb domain protein 86