PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g46020.1
Common NameLOC4339451, OJ1741_B01.16, Os05g0537100, OsJ_19359, OSNPB_050537100, WRKY7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 222aa    MW: 23174.4 Da    PI: 7.141
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g46020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.52.1e-31134192159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg+Hnh 
  LOC_Os05g46020.1 134 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDKDDPSYVVTTYEGTHNHV 192
                       59********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.4E-34120194IPR003657WRKY domain
SuperFamilySSF1182903.4E-28126194IPR003657WRKY domain
PROSITE profilePS5081131.732129194IPR003657WRKY domain
SMARTSM007741.6E-35134193IPR003657WRKY domain
PfamPF031064.5E-25135191IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAAVGAHAAV YHHPVSGLSA PAGDAAYSMS SYFSHGGSST SSSASSFSAA LAAATTPPLP  60
DPSGSQFDIS EFFFDDAPPA AVFNGAPTAA LPDGAAANAT RSAAEAVPAP APAAVERPRT  120
ERIAFRTKSE IEILDDGYKW RKYGKKSVKN SPNPRNYYRC STEGCNVKKR VERDKDDPSY  180
VVTTYEGTHN HVSPSTVYYA SQDAASGRFF VAGTQPPGSL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-27124195778Probable WRKY transcription factor 4
2lex_A7e-27124195778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.89610.0callus| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976048230.0
Expression AtlasQ6IES4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g46020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g46020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981790.0DQ298179.1 Oryza sativa WRKY transcription factor 7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637886.11e-160PREDICTED: probable WRKY transcription factor 50
SwissprotQ93WU94e-42WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLA0A0D3GA841e-160A0A0D3GA84_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HHD11e-160A0A0E0HHD1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PQH51e-160A0A0E0PQH5_ORYRU; Uncharacterized protein
TrEMBLQ20DQ11e-160Q20DQ1_ORYSA; WRKY transcription factor 7
TrEMBLQ6IES41e-160Q6IES4_ORYSJ; Os05g0537100 protein
STRINGLOC_Os05g46020.11e-159(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.17e-40WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]