PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g44400.1
Common NameLOC4339348, Os05g0520300, OSNPB_050520300, P0483D07.7, P0599F04.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 387aa    MW: 39440.3 Da    PI: 6.7726
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g44400.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.2e-18255289135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  LOC_Os05g44400.1 255 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 289
                       99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.3E-18249299IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.479249285IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.5E-15250286IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.57E-15251312No hitNo description
CDDcd002024.51E-14254301No hitNo description
PfamPF003201.4E-15255289IPR000679Zinc finger, GATA-type
PROSITE patternPS003440255280IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEVAAADYAG GVRVKKEAGG CGGSGDMFLV DDLLDLPCDE EEEETGLCGA YGGGGAGLGA  60
GVVGGGGDDR AAGNASADSS TVTAVDSCSN SFSGLADGDF SGGLCEPYEQ LAELEWVSTY  120
MGEETLPTED LRKLQLISGI PAAPRAPPAL AVSAVQLPAG GAGALPTEAP VPGKARSKRS  180
RVAPCSWSSR LMVLPPPPAS PPSPASAVIS PSESGTAAPA FPAKKAAKSA KKKDGPSPAP  240
APNAAAQAAA EGRRCLHCET DKTPQWRTGP MGPKTLCNAC GVRYKSGRLV PEYRPAASPT  300
FVVSKHSNSH RKVVELRRQK EMQLLHHHQQ PPPHVGAGGG GAAGGLLHVT SPLLFDGPTS  360
SAPLFAGADE FLIHNRISPD YRRQAT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.759870.0panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166313090.0
Expression AtlasQ6F2Z7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g44400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g44400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8376640.0CT837664.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA206K19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638019.10.0PREDICTED: GATA transcription factor 12
TrEMBLA0A0E0ITL20.0A0A0E0ITL2_ORYNI; Uncharacterized protein
TrEMBLA2Y6M00.0A2Y6M0_ORYSI; Putative uncharacterized protein
TrEMBLQ6F2Z70.0Q6F2Z7_ORYSJ; Os05g0520300 protein
STRINGBGIOSGA020209-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g44400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.15e-46GATA transcription factor 12