PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g43950.1
Common NameLOC4339316, Os05g0515700, OSNPB_050515700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family VOZ
Protein Properties Length: 642aa    MW: 69902.1 Da    PI: 5.4343
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g43950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.13.6e-1293085251217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                       p+ps++lgpkcalwdc rp++gs+++q+yc+ +ha laln+ gl+gt+pv+rp+gidlkdg+lfaalsakvqgk+vgip+cegaat+kspwna
  LOC_Os05g43950.1 308 PSPSQYLGPKCALWDCGRPVRGSDECQHYCNPYHAGLALNDdGLLGTRPVMRPRGIDLKDGPLFAALSAKVQGKNVGIPVCEGAATTKSPWNA 400
                       89**************************************9799************************************************* PP

               VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrl 185
                       +elfdlsllege++rewlffd+prraf+sgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpss++ewhl+eye+n++dalalyrl
  LOC_Os05g43950.1 401 PELFDLSLLEGESLREWLFFDTPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSNYEWHLFEYETNDSDALALYRL 493
                       ********************************************************************************************* PP

               VOZ 186 elklvdekksakgkvskdsladlqkklgrlta 217
                       e+k++d+k+s+k+k+++++l+++q++++rl+a
  LOC_Os05g43950.1 494 EYKSSDTKRSVKSKLASSPLSEIQQQMVRLSA 525
                       ******************************97 PP

Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MAGDPAAGGD GGRGSSGGKG SSPSSSRHQQ FRNLAKTRVD DLQEMFSGLQ SARKESRSAD  60
AALLEEQVHH MLREWRAELN VPSPASSLQN SQSQGNNREA SDPPSETLRL LQLAGAEEED  120
DATSKLVMPR SPMPMQSSHE GHNLSPVLQG GTMAGGAAEL MVPRSPLQQM PSSHQSHGHG  180
QDGGQNLQGE AVMGSTAATA APHLGQGMQG DCGGMAGVTN AMFHDQLYYI DHELNIDDFL  240
QDDDYKINLP GSNPDGPNTM QGIGQLEHQQ YNLPLDLPPN SFVDANNSAQ SSGDVFFHMS  300
DLLTTMCPSP SQYLGPKCAL WDCGRPVRGS DECQHYCNPY HAGLALNDDG LLGTRPVMRP  360
RGIDLKDGPL FAALSAKVQG KNVGIPVCEG AATTKSPWNA PELFDLSLLE GESLREWLFF  420
DTPRRAFDSG NRKQRSLPDY NGRGWHESRK QVMKDFGGLK RSYYMDPQPS SNYEWHLFEY  480
ETNDSDALAL YRLEYKSSDT KRSVKSKLAS SPLSEIQQQM VRLSADSPVE SKRTARSRAK  540
ANQKDNNSNA YPALNTPVQV SASNAHQTMS VNTPDQVNVS NAYQTMPLNT PNQPGPSNAY  600
HAASQMDQMT FLDGSVVYGP HLPYGYSTER SDFYWNPSDG T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.272010.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329791000.0
Expression AtlasQ0DGR8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g43950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g43950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0690760.0AK069076.1 Oryza sativa Japonica Group cDNA clone:J023004H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640409.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-115VOZ1_ARATH; Transcription factor VOZ1
TrEMBLQ0DGR80.0Q0DGR8_ORYSJ; Os05g0515700 protein
STRINGLOC_Os05g43950.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23271335
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-111vascular plant one zinc finger protein