PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g43920.1
Common NameARF14, LOC4339313, Os05g0515400, P0022D06.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 700aa    MW: 75519.8 Da    PI: 6.8669
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g43920.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.41e-21133246199
                       EEEE-..-HHHHTT-EE--HHH.HTT..................---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT-- CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..................ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk 75 
                       f+k+lt sd++++g +++p++ ae++                  + +   s++l+  d++g +W++++iyr++++r++lt GW++Fv+ ++L 
  LOC_Os05g43920.1 133 FCKTLTASDTSTHGGFSVPRRAAEDCfpplvihlkeklvtfndyKTVR-PSQELIAVDLHGTQWKFRHIYRGQPRRHLLTIGWSSFVNRKKLV 224
                       99******************************8888888887653332.5579**************************************** PP

                       TT-EEEEEE-SSSEE..EEEEE-S CS
                B3  76 egDfvvFkldgrsefelvvkvfrk 99 
                       +gD v+F   + ++++l+++v+r+
  LOC_Os05g43920.1 225 SGDAVLFL--RGDDGQLRLGVRRA 246
                       ********..34888899999986 PP

2Auxin_resp1064.2e-35271351182
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                       +a+++++ksvF++++nPr+++seF+v++++++k+l++++s+GmRf++ +e+ed++er+ +G+++g+s++dp+rWp+S+W++L
  LOC_Os05g43920.1 271 VASSLENKSVFHICFNPRSGASEFIVPYWRLLKSLNHPFSIGMRFRVCYESEDANERS-AGLISGISEVDPIRWPGSRWKCL 351
                       578899***************************************************9.9*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.92E-37122283IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.8E-35128248IPR015300DNA-binding pseudobarrel domain
CDDcd100171.17E-19131245No hitNo description
PROSITE profilePS5086311.561133247IPR003340B3 DNA binding domain
PfamPF023621.1E-19133246IPR003340B3 DNA binding domain
SMARTSM010198.8E-21133247IPR003340B3 DNA binding domain
PfamPF065072.0E-27272351IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MGIDLNTVEE EAEEGAAAAV CGELWHACAG PGVALPRRGS ALVYLPQAHL AADGGGGEVP  60
PAGAAAVPPH VACRVVGVEL RADAATDEVY ARLALVAEGE MLQRNFREGG GEDGAGEMEG  120
CDAEKKPRMP HMFCKTLTAS DTSTHGGFSV PRRAAEDCFP PLVIHLKEKL VTFNDYKTVR  180
PSQELIAVDL HGTQWKFRHI YRGQPRRHLL TIGWSSFVNR KKLVSGDAVL FLRGDDGQLR  240
LGVRRAVQLR NEALFEPVNS SDSKLRILSS VASSLENKSV FHICFNPRSG ASEFIVPYWR  300
LLKSLNHPFS IGMRFRVCYE SEDANERSAG LISGISEVDP IRWPGSRWKC LLVRWDDSTD  360
SSHQNRVSPW EIERVGGSVS VTHSLSSGSK RTKLHFPQGS LDTPFLNGNG HPDSMGTENF  420
HRVLQGQEFR GSRSHGVVCS ESPGVPNFQS PDNRRFSADM RGYMMPASGP PQRNTEFTYQ  480
PIGFSESLGF PEVLQGQEMS QVVPLFRGAT FGARTQNDRV VSANSVHRSA AQSGLLASTL  540
GHPISQFTLS SSKVSSPSSV LMFNQATAPN HETVSGTNNK GMHVSQFASQ EMLSETVTWP  600
GTQRQTPSEI TSNQFALARI PAPPSGAESG LPKRDAGRSS CRLFGFSLTG NMLGEDGEGL  660
DDGAIEAGCE NPPVLELFGH SHSTPGALHA LCAAAPLGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A8e-911937318353Auxin response factor 1
4ldy_B8e-911937318353Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.507720.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329779450.0
Expression AtlasQ0DGS1-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g43920.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin under light condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g43920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679270.0AK067927.1 Oryza sativa Japonica Group cDNA clone:J013127F13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637659.10.0PREDICTED: auxin response factor 14
SwissprotQ0DGS10.0ARFN_ORYSJ; Auxin response factor 14
TrEMBLA0A0E0PPY20.0A0A0E0PPY2_ORYRU; Auxin response factor
STRINGLOC_Os05g43920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1425444
MonocotsOGMP51132756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-137ARF family protein
Publications ? help Back to Top
  1. Wang D, et al.
    Genome-wide analysis of the auxin response factors (ARF) gene family in rice (Oryza sativa).
    Gene, 2007. 394(1-2): p. 13-24
    [PMID:17408882]