PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g43380.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 231aa    MW: 24871.9 Da    PI: 8.5641
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g43380.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.92.4e-1485122340
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+C Ckks+Clk+YC Cfa g +Cse+C C+ C+Nk 
  LOC_Os05g43380.2  85 CKHCACKKSRCLKLYCPCFAGGGYCSEKCGCQPCFNKA 122
                       89**********************************85 PP

2TCR513e-16170206339
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++gCnCkks+ClkkYC+C+++g+ Cs  C+CedC+N 
  LOC_Os05g43380.2 170 RRGCNCKKSSCLKKYCDCYQDGTGCSLFCRCEDCRNP 206
                       589********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-1283124IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.30384208IPR005172CRC domain
PfamPF036382.7E-1086121IPR005172CRC domain
SMARTSM011141.7E-15168209IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-11171205IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEATPISVKP PSPVAAAPPP PPVQVPVPPP PPPPLPPAAA AVEPLPPQPV AVVVAEAEPC  60
SMNQLALTPT PKRQKVEESA DGNGCKHCAC KKSRCLKLYC PCFAGGGYCS EKCGCQPCFN  120
KALYAETVQT TRKVLLSRQK RMSLKINRRS EANAEAVEDA HHSSSSTPPR RGCNCKKSSC  180
LKKYCDCYQD GTGCSLFCRC EDCRNPFGKN GTKDMLLISH IYFCKQFLSF *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.231260.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329932620.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g43380.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g43380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1080530.0AK108053.1 Oryza sativa Japonica Group cDNA clone:002-137-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640211.11e-150PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X1
SwissprotQ8L5489e-44TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLB8AZT21e-150B8AZT2_ORYSI; Putative uncharacterized protein
TrEMBLQ6L4W51e-150Q6L4W5_ORYSJ; Os05g0509400 protein
STRINGBGIOSGA017747-PA1e-150(Oryza sativa Indica Group)
STRINGLOC_Os05g43380.11e-150(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.16e-43Tesmin/TSO1-like CXC domain-containing protein