PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g42130.1
Common NameLOC4339232, OJ1057_B02.15, Os05g0500600, OSJNBa0017K09.1, OSNPB_050500600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 426aa    MW: 45430.8 Da    PI: 6.1368
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g42130.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS258.32.7e-79374232374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsely..kalppsetsekn...sseelaalkl..fsev 87 
                       ++lLl+cA a++s+d +laq++++ l+++as++gdp qRl++ +++AL ar  r +      +a++  e    +     +++++++l  ++++
  LOC_Os05g42130.1  37 QQLLLHCAAALESNDVTLAQQAMWVLNNIASSQGDPSQRLTSWLLRALVARACRLCAAAPagAAVEFLERG--RappWGRAMSVTELadYVDL 127
                       699***************************************************44443300333333333..2356555555566688**** PP

              GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfe 177
                       +P+++f++ + N aIl+av+g+++vH++D+++++++QWp+L++ L++Rp+g+p +RiT+ +   ++    + + +e+g rLa fA++ gv++e
  LOC_Os05g42130.1 128 TPWHRFGFTASNAAILRAVAGASAVHVVDLSVTHCMQWPTLIDVLSKRPGGAPAIRITVPSVRPAVpplLAVSSSELGARLAIFAKSKGVQLE 220
                       **********************************************************9887555578889999******************* PP

              GRAS 178 fnvl..............vakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                       fnv+              ++++l+++  ++ +L ++ gEa++Vn++  l ++       +++rd +L++v+ l+P +++v++++ad++s+s++
  LOC_Os05g42130.1 221 FNVVesatttspkktsttLCQELASVlsDPPSLGLRDGEAVVVNCQSWLRHVA------PDTRDLFLDTVRALNPCLLTVTDEDADLGSPSLA 307
                       ****998888776655443344443367888889999************9998......66789***************************** PP

              GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                        r++ ++++++ l+d+l++++p++s  r   E++ +gr+i++v+  e  +  er e  ++  er+++ GF  v ++e+aa+++++ll++++  
  LOC_Os05g42130.1 308 SRMAGCFDFHWILLDALDMSAPKDSPRRLEQEAA-VGRKIESVIGEEDGA--ERSEPGARLAERMSRKGFAGVVFDEEAAAEVRRLLSEHA-T 396
                       ****************************999999.**********99988..9**************************************.9 PP

              GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                       g+ v+ e++ lvl+Wk+++ v++ aW+
  LOC_Os05g42130.1 397 GWGVKREDDMLVLTWKGHAAVFTGAWT 423
                       9*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.70910404IPR005202Transcription factor GRAS
PfamPF035149.3E-7737423IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MDMEHELRGG GVGAAAHGHG SICFSGGPVL VDGRRIQQLL LHCAAALESN DVTLAQQAMW  60
VLNNIASSQG DPSQRLTSWL LRALVARACR LCAAAPAGAA VEFLERGRAP PWGRAMSVTE  120
LADYVDLTPW HRFGFTASNA AILRAVAGAS AVHVVDLSVT HCMQWPTLID VLSKRPGGAP  180
AIRITVPSVR PAVPPLLAVS SSELGARLAI FAKSKGVQLE FNVVESATTT SPKKTSTTLC  240
QELASVLSDP PSLGLRDGEA VVVNCQSWLR HVAPDTRDLF LDTVRALNPC LLTVTDEDAD  300
LGSPSLASRM AGCFDFHWIL LDALDMSAPK DSPRRLEQEA AVGRKIESVI GEEDGAERSE  360
PGARLAERMS RKGFAGVVFD EEAAAEVRRL LSEHATGWGV KREDDMLVLT WKGHAAVFTG  420
AWTPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-28364224374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.530200.0flower| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329805130.0
Expression AtlasQ6AUW2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g42130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g42130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1305970.0AC130597.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0017K09, complete sequence.
GenBankAC1133320.0AC113332.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1057_B02, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankAK0704890.0AK070489.1 Oryza sativa Japonica Group cDNA clone:J023050L12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638716.10.0PREDICTED: scarecrow-like protein 32
TrEMBLQ6AUW20.0Q6AUW2_ORYSJ; Os05g0500600 protein
STRINGLOC_Os05g42130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
MonocotsOGMP122273238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.17e-96GRAS family protein