PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g41450.1
Common NameLOC4339189, OJ1579_G03.2, Os05g0494100, OsDrAp2, OsJ_19042, OSNPB_050494100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YC
Protein Properties Length: 291aa    MW: 32214.9 Da    PI: 4.8932
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g41450.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC62.58.6e-206861898
             NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                      ++++P  rikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +tl  s +++++ + +++dfl d+v +
  LOC_Os05g41450.1  6 DTRFPAPRIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCNRTYDITVQRGVKTLSSSHLKQCIHSYNVYDFLRDVVSK 86
                      5789**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.5E-25372IPR009072Histone-fold
SuperFamilySSF471134.56E-20488IPR009072Histone-fold
PfamPF008083.2E-18871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MRKKLDTRFP APRIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCNRT YDITVQRGVK  60
TLSSSHLKQC IHSYNVYDFL RDVVSKVPDM GTSDAGVDDK LGKRRKTAED DSEEESKRTR  120
NEAASQTSTG RGRGRGRGRG RRGGRVSERE IISAYEKFEE NHEFPPGQFS KPSQLKVDVS  180
VDGTDAIETK EATPLSNARA SLRNIDLNIE LTDYDDEGSA PLEVQPPAPA AGVVTTSSGP  240
LVSEVNEEAK TKDFLGWQLP ELTKMAMDPV QFALSSNHRL EEDEDYDNEE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A4e-23271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130139RGRGRGRGRG
2130140RGRGRGRGRGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.510180.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329783380.0
Expression AtlasQ65X80-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g41450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g41450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880480.0AB288048.1 Oryza sativa Japonica Group OsDrAp2 mRNA for repressor protein, complete cds.
GenBankAK0683200.0AK068320.1 Oryza sativa Japonica Group cDNA clone:J013150F08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639312.10.0PREDICTED: dr1-associated corepressor
TrEMBLA0A0E0HGA60.0A0A0E0HGA6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PPD40.0A0A0E0PPD4_ORYRU; Uncharacterized protein
TrEMBLA2Y6270.0A2Y627_ORYSI; Putative uncharacterized protein
TrEMBLQ65X800.0Q65X80_ORYSJ; Os05g0494100 protein
STRINGBGIOSGA020099-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g41450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21791635
MonocotsOGMP21723679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.17e-55nuclear factor Y, subunit C11
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]