PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g41280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 306aa    MW: 34411.9 Da    PI: 7.7997
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g41280.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-102563846
                      HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46
                      rr+++NReAAr+sR+RKka++++Le+   +L++  ++L+
  LOC_Os05g41280.1 25 RRLAQNREAARKSRLRKKAYVQQLEDSRMKLTQLEQELQ 63
                      9************************99888888776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-51787IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.97E-72465No hitNo description
PfamPF001703.5E-72463IPR004827Basic-leucine zipper domain
PROSITE patternPS0003602540IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.7722564IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-82567No hitNo description
PfamPF141441.0E-30104179IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MVYASPGTDA STDPDIDKNI RMTLRRLAQN REAARKSRLR KKAYVQQLED SRMKLTQLEQ  60
ELQRARQQGI IISTSGDQQR STSENEALAF NMEYMRWLEE HNKQINELRS AVHTHAGDDD  120
LQNIVSSVMA HHEEIFRIKG LAAKADALHV LSATWRTPLE RCFLWLGGFR PSDLLKLLAD  180
QLEPLTEQQL ASIYNQQQSS QQAEETLSQG MEIIQDSLAK TVASQLGRAG SSSPSNAADH  240
TAAALGKIGD MESLLQQADD LRMQSLQKMQ RVLTTRQSAR ALLLVSDYFS RLRALNSLWI  300
ARPQQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g41280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g41280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1297181e-150AC129718.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0088I06, complete sequence.
GenBankAP0149611e-150AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639148.10.0PREDICTED: transcription factor HBP-1b(c1)-like isoform X1
SwissprotQ415581e-145HBP1C_WHEAT; Transcription factor HBP-1b(c1) (Fragment)
TrEMBLA0A0E0PPC10.0A0A0E0PPC1_ORYRU; Uncharacterized protein
STRINGLOC_Os05g41280.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7221667
MonocotsOGMP169461111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06950.41e-122bZIP family protein