PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g41240.1
Common NameOsJ_19028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 258aa    MW: 28529.1 Da    PI: 6.9705
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g41240.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81.1e-324599155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQkYRl
  LOC_Os05g41240.1 45 KQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 99
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.74242102IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-3143100IPR009057Homeodomain-like
SuperFamilySSF466891.0E-164499IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2545100IPR006447Myb domain, plants
PfamPF002492.6E-74798IPR001005SANT/Myb domain
PfamPF143792.3E-24131177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MMYHAKKFSV PFGPQSTQSN EHMSNIGAFG GSNMGSPANP AGSGKQRLRW TSDLHNRFVD  60
AIAQLGGPDR ATPKGVLTVM GVPGITIYHV KSHLQKYRLA KYIPESPAEG SKDEKKDSSD  120
SLSNTDSAPG MQINEALKMQ MEVQKRLHEQ LEVQRQLQLR IEAQGKYLQM IIEEQQKLGG  180
SLKACEEQKL PHSPPSLDDY PDSMQPSPKK PKMDNLSPDS VRDVTQSDFE SHLIGPWDQE  240
AAFRVDEFKA DPGLNKS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.139780.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329793300.0
Expression AtlasB9FKW8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g41240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g41240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0693060.0AK069306.1 Oryza sativa Japonica Group cDNA clone:J023012H08, full insert sequence.
GenBankAK0619870.0AK061987.1 Oryza sativa Japonica Group cDNA clone:001-043-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639152.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015639153.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015639154.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015639155.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN58e-50PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0E0A1150.0A0A0E0A115_9ORYZ; Uncharacterized protein
TrEMBLB9FKW80.0B9FKW8_ORYSJ; Uncharacterized protein
TrEMBLQ6F3350.0Q6F335_ORYSJ; Os05g0491500 protein
STRINGLOC_Os05g41240.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP79133343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.19e-56G2-like family protein