PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g41166.1
Common NameLOC4339167, Os05g0490600, OSNPB_050490600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 395aa    MW: 45133.3 Da    PI: 5.0147
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g41166.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-174390148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT +Ed +l +++k++G ++Wk++ +  g+ R++k+c++rw ++l
  LOC_Os05g41166.1 43 KGPWTSWEDSILEKYIKKHGERNWKLVQKNTGLLRCGKSCRLRWMNHL 90
                      79******************************99************97 PP

2Myb_DNA-binding49.21.2e-1596139146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++++eE+ +++++++++G++ W++ a+ ++ gRt++++k++w++
  LOC_Os05g41166.1  96 KGAFSKEEENKIINLHRKMGNK-WSRMAADLP-GRTDNEIKNYWNT 139
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0094190IPR017930Myb domain
SMARTSM007174.8E-144292IPR001005SANT/Myb domain
SuperFamilySSF466892.03E-2642137IPR009057Homeodomain-like
PfamPF002497.7E-154390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-214497IPR009057Homeodomain-like
CDDcd001671.98E-114590No hitNo description
PROSITE profilePS5129423.15891145IPR017930Myb domain
SMARTSM007172.6E-1595143IPR001005SANT/Myb domain
PfamPF002491.7E-1496139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2598143IPR009057Homeodomain-like
CDDcd001674.85E-1198139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MHESDSDPDS DRTHWYMSNS DDESFVDKDK DCRRSTVALL LKKGPWTSWE DSILEKYIKK  60
HGERNWKLVQ KNTGLLRCGK SCRLRWMNHL RPNLKKGAFS KEEENKIINL HRKMGNKWSR  120
MAADLPGRTD NEIKNYWNTR IKKCKNNRSP LYPANVCNDA LNEDQHESAD PNVREKLTNN  180
HLEDTTSMYS APQFSDASIS NILDRRLASK DYDSIEDQRN QIEVVAKYEI PLPVLKTTNN  240
DIFPSASIFA NHGISNGNLS ALSTTDALQM ELPLIQFDPN NQFVYSRAYA MHLTNFALLN  300
DQSEELLNDT DVLNYVVMKE ELSGGSLSPT INMPCEAHNS MAASNELVVP QYEGDAPPLQ  360
DDFTSYFYLN DTNLSIFEDT NELFLENKLD TKGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27411435106B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO26056240.0
Expression AtlasQ0DH57-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g41166.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g41166
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886210.0D88621.1 Oryza sativa mRNA for OSMYB5, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639103.10.0PREDICTED: transcription factor GAMYB
SwissprotA2WW872e-80GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC22e-80GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA2Y6040.0A2Y604_ORYSI; Putative uncharacterized protein
TrEMBLQ0DH570.0Q0DH57_ORYSJ; Os05g0490600 protein
STRINGBGIOSGA017818-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g41166.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP154081018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.12e-58myb domain protein 33