PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g41070.1
Common NameLOC4339158, OJ1119_H02.18, Os05g0489700, OSNPB_050489700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 336aa    MW: 35575 Da    PI: 6.5434
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g41070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1475.4e-15265308548
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                       +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  LOC_Os05g41070.1 265 RRQKRMIKNRESAARSRARKQAYTNELENKVLRLEEENERLKKQ 308
                       79***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.4E-14260308No hitNo description
SMARTSM003388.2E-10261317IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.553263308IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-10265310No hitNo description
CDDcd147077.47E-24265312No hitNo description
PfamPF001701.4E-12265308IPR004827Basic-leucine zipper domain
PROSITE patternPS000360268283IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MIQAMASHAG GSGGGGGGSG RDAGSAQRGP MQGLARQGSL YGLTLNEVQS QLGEPLLSMN  60
LDELLKSVFP DGADLDGGGG GGGIAGQSQP ALGLQRQGSI TMPPELSKKT VDEVWKGIQD  120
VPKRGAEEGG RWRRERQPTL GEMTLEDFLV KAGVVTDPND LPGNMDVVGG AAAAAAGTSD  180
LNAGAQWLQQ YHQQALEPQH PSIGAPYMAT HLAPQPLAVA TGAVLDPIYS DGQITSPMLG  240
ALSDPQTPGR KRCATGEIAD KLVERRQKRM IKNRESAARS RARKQAYTNE LENKVLRLEE  300
ENERLKKQKE LDEILNSAPP PEPKYQLRRT SSAAF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.481330.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329734160.0
Expression AtlasQ6AVM5-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g41070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g41070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0633980.0AK063398.1 Oryza sativa Japonica Group cDNA clone:001-114-H11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638733.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES33e-87AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLQ6AVM50.0Q6AVM5_ORYSJ; BZIP transcription factor
STRINGLOC_Os05g41070.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5401580
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.15e-65ABA-responsive element binding protein 3