PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os05g40960.1
Common NameLOC4339151, Os05g0488600, OsJ_19007, OSNPB_050488600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 412aa    MW: 46001.3 Da    PI: 7.1023
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os05g40960.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.1e-344498155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprl+WtpeLH+rFv+av+qLGG+ekAtPkt+++lm+++gLtl+h+kSHLQkYRl
  LOC_Os05g40960.1 44 KPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 98
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.38741101IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-324299IPR009057Homeodomain-like
SuperFamilySSF466898.6E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-234499IPR006447Myb domain, plants
PfamPF002497.7E-104697IPR001005SANT/Myb domain
PfamPF143792.8E-22145192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MYHQHQGRSD LFTTRTSFPM ERHLFLHGGN TQGDSGLVLS TDAKPRLKWT PELHQRFVDA  60
VNQLGGAEKA TPKTVMRLMG IPGLTLYHLK SHLQKYRLSK NLQGQANVGT TKNALGCTGV  120
ADRIPGTSAL AMASASAIPQ AEKTIQIGEA LQMQIEVQRQ LNEQLEVQRH LQLRIEAQGK  180
YLQAVLEQAQ ETLGKQNLGP ASLEDAKIKI SELVSQVSNE CLSNAVTEIR ESSSIHRLEP  240
RQIQFVESSA NNCLTAAEGF KEHRLQNHGV LKAYDDSTLF CRKQSQDQES QYSLNRSLSE  300
RRMGHLYSGK QYHKSEGSDS DTEVLHEYIT PQKNGGGSTT SSTSGSKEIN VEKLYLDEPS  360
CKRQTVDYQR ESKLLDFDQQ SSGKNLDLNT HNIDDNDQGY RHFDLNGFSW S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.704190.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160107270.0
Expression AtlasB9FKV5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os05g40960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs05g40960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413620.0AK241362.1 Oryza sativa Japonica Group cDNA, clone: J065151H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640413.10.0PREDICTED: uncharacterized protein LOC4339151 isoform X1
RefseqXP_015640414.10.0PREDICTED: uncharacterized protein LOC4339151 isoform X1
RefseqXP_015640415.10.0PREDICTED: uncharacterized protein LOC4339151 isoform X1
TrEMBLB9FKV50.0B9FKV5_ORYSJ; Os05g0488600 protein
STRINGLOC_Os05g40960.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP122793137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-100myb-related protein 1